NLRP3/NALP3 Antibody

Images

 
Immunohistochemistry-Paraffin: NLRP3/NALP3 Antibody [NBP1-90207] - Staining of human tonsil shows moderate cytoplasmic positivity in germinal and non-germinal center cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NLRP3/NALP3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FKMHLEDYPPQKGCIPLPRGQTEKADHVDLATLMIDFNGEEKAWAMAVWIFAAINRRDLYEKAKRDEPKWGSDNARVSNPTVICQEDSIEEEWMGLLEYLSRISICKMKKDYRKKYR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NLRP3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Western Blot reactivity reported in scientific literature (PMID: 24006511).
Theoretical MW
118 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
NLRP3/NALP3 Protein (NBP1-90207PEP)
Publications
Read Publications using
NBP1-90207 in the following applications:

  • WB
    2 publications

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 20434582).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NLRP3/NALP3 Antibody

  • AGTAVPRL
  • AII
  • AII/AVP
  • Angiotensin/vasopressin receptor AII/AVP-like
  • AVP
  • C1orf7
  • Caterpiller protein 1.1
  • CIAS1
  • CLR1.1
  • Cold autoinflammatory syndrome 1 protein
  • Cold autoinflammatory syndrome 1
  • Cryopyrin
  • Familial cold autoinflammatory syndrome
  • FCAS
  • FCU
  • Leucine-rich repeat-, and PYD-containing protein 3
  • Muckle-Wells syndrome
  • MWS
  • NACHT
  • NACHT, LRR and PYD containing protein 3
  • NACHT, LRR and PYD domains-containing protein 3
  • NALP3
  • NLR family, pyrin domain containing 3
  • NLRP3
  • Nucleotide-Binding Oligomerization Domain, Leucine Rich Repeat And Pyrin Domain Containing 3
  • PYPAF1
  • PYRIN-containing APAF1-like protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-35703
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-52131
Species: Hu
Applications: IHC, PEP-ELISA
NBP1-52131
Species: Hu
Applications: IHC, PEP-ELISA
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-78977
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-56565
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
AF4090
Species: Hu
Applications: WB, IHC, IP, Neut
NBP2-14873
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB110-74682
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
9134-TN
Species: Hu
7570-GH
Species: Hu
NBP1-90207
Species: Hu
Applications: WB, IHC, IHC-P

Publications for NLRP3/NALP3 Antibody (NBP1-90207)(5)

Reviews for NLRP3/NALP3 Antibody (NBP1-90207) (0)

There are no reviews for NLRP3/NALP3 Antibody (NBP1-90207). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NLRP3/NALP3 Antibody (NBP1-90207). (Showing 1 - 4 of 4 FAQs).

  1. Are the NLRP3/NALP3 antibodies validated in Simple Western?
    • Yes, we offer a NLRP3/NALP3 antibody that have been tested in Simple Western: NBP2-03948.
  2. Does NLRP3/NALP3 antibodies come in lyophilized form?
    • Yes, we carry 3 NLRP2 antibodies in lyophilized format: AF6789, AF7010, MAB6789, MAB7578.
  3. What is the theoretical molecular weight for NLRP3/NALP3 antibodies?
    • The TMW of NLRP3/NALP3 antibodies is approximately 118 kDa.
  4. What is the immunogen sequence of this NLRP3/NALP3 antibodies antibody?
    • A recombinant sequence corresponding to amino acids: FKMHLEDYPPQKGCIPLPRGQTEKADHVDLATLMIDFNGEEKAWAMAVWIFAAINRRDLYEKAKRDEPKWGSDNARVSNPTVICQEDSIEEEWMGLLEYLSRISICKMKKDYRKKYR.

Secondary Antibodies

 

Isotype Controls

Additional NLRP3/NALP3 Products

Bioinformatics Tool for NLRP3/NALP3 Antibody (NBP1-90207)

Discover related pathways, diseases and genes to NLRP3/NALP3 Antibody (NBP1-90207). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NLRP3/NALP3 Antibody (NBP1-90207)

Discover more about diseases related to NLRP3/NALP3 Antibody (NBP1-90207).
 

Pathways for NLRP3/NALP3 Antibody (NBP1-90207)

View related products by pathway.

PTMs for NLRP3/NALP3 Antibody (NBP1-90207)

Learn more about PTMs related to NLRP3/NALP3 Antibody (NBP1-90207).
 

Research Areas for NLRP3/NALP3 Antibody (NBP1-90207)

Find related products by research area.

Blogs on NLRP3/NALP3.

NLRP3/NALP3 - Sensing and responding to pathogen infection
The inflammasome is a multi protein complex that is an important component of the innate immune response. The inflammasome is able to sense and respond to pathogen infections by recognizing pathogen-associated molecular patterns and mediating the ...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NLRP3/NALP3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NLRP3
Entrez
Uniprot