Steroid sulfatase Antibody - BSA Free

Images

 
Orthogonal Strategies: Analysis in human placenta and pancreas tissues using Anti-STS antibody. Corresponding STS RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Steroid sulfatase Antibody [NBP1-90095] - Staining of human placenta shows high expression.
Immunohistochemistry-Paraffin: Steroid sulfatase Antibody [NBP1-90095] - Staining of human pancreas shows low expression as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Validated by:
       

Orthogonal Strategies

 

Order Details

View Available Formulations
Catalog# & Formulation Size Price

Steroid sulfatase Antibody - BSA Free Summary

Description
Novus Biologicals Rabbit Steroid sulfatase Antibody - BSA Free (NBP1-90095) is a polyclonal antibody validated for use in IHC. Anti-Steroid sulfatase Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: YEIIQQPMSYDNLTQRLTVEAAQFIQRNTETPFLLVLSYLHVHTALFSSKDFAGKSQHGVYGDAVEEMDWSVGQILNLLDELRLANDTLIYFTSDQGAHVEEVSSKGEIHGGSNGIY
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Steroid sulfatase Protein (NBP1-90095PEP)
Publications
Read Publications using
NBP1-90095 in the following applications:

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25817828).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Steroid sulfatase Antibody - BSA Free

  • ARSC1
  • ARSC1ES
  • ARSCsteroid sulfatase (microsomal), arylsulfatase C, isozyme S
  • Arylsulfatase C
  • ASC
  • EC 3.1.6
  • EC 3.1.6.2
  • Estrone sulfatase
  • SSDD
  • steroid sulfatase (microsomal), isozyme S
  • Steroid sulfatase
  • steryl-sulfatase
  • Steryl-sulfate sulfohydrolase
  • STS
  • XLI

Background

Steroid sulfatase is encoded by this gene catalyzes the conversion of sulfated steroid precursors to estrogens during pregnancy. The encoded protein is found in the endoplasmic reticulum, where it acts as a homodimer. Mutations in this gene are known to cause X-linked ichthyosis (XLI).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90095
Species: Hu
Applications: IHC,  IHC-P
NBP2-12446
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IM, IP, KD, WB
NBP1-78977
Species: Hu, Mu, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC,  IHC-P, IM, IP, Simple Western, WB
NB100-56565
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
AF1759
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
NB100-1596
Species: Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
M6000B
Species: Mu
Applications: ELISA
7734-LF
Species: Hu
Applications: BA
7625
Species: Mu
Applications: ELISA
NB600-809
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
DVE00
Species: Hu
Applications: ELISA
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP1-00154
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
AF1997
Species: Hu
Applications: ChIP, ICC, IHC, Simple Western, WB

Publications for Steroid sulfatase Antibody (NBP1-90095)(3)

Reviews for Steroid sulfatase Antibody (NBP1-90095) (0)

There are no reviews for Steroid sulfatase Antibody (NBP1-90095). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Steroid sulfatase Antibody (NBP1-90095) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Steroid sulfatase Products

Research Areas for Steroid sulfatase Antibody (NBP1-90095)

Find related products by research area.

Blogs on Steroid sulfatase

There are no specific blogs for Steroid sulfatase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Steroid sulfatase Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol STS