Steroid sulfatase Antibody

Images

 
Immunohistochemistry: Steroid sulfatase Antibody [NBP1-90095] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Steroid sulfatase Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:YEIIQQPMSYDNLTQRLTVEAAQFIQRNTETPFLLVLSYLHVHTALFSSKDFAGKSQHGVYGDAVEEMDWSVGQILNLLDELRLANDTLIYFTSDQGAHVEEVSSKGEIHGGSNGIY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Steroid sulfatase Protein (NBP1-90095PEP)
Publications
Read Publications using
NBP1-90095 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25817828).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Steroid sulfatase Antibody

  • ARSC1ES
  • ARSCsteroid sulfatase (microsomal), arylsulfatase C, isozyme S
  • Arylsulfatase C
  • ASC
  • EC 3.1.6
  • EC 3.1.6.2
  • estrone sulfatase
  • SSDD
  • steroid sulfatase (microsomal), isozyme S
  • Steroid sulfatase
  • steryl-sulfatase
  • Steryl-sulfate sulfohydrolase
  • XLI

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP2-12446
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-78977
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-56565
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
MAB5545
Species: Hu
Applications: WB
NBP2-17262
Species: Hu
Applications: WB, ICC/IF
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
AF2485
Species: Hu
Applications: WB, IHC, IP
AF1997
Species: Hu
Applications: WB, ChIP, ICC
NBP1-90095
Species: Hu
Applications: IHC, IHC-P

Publications for Steroid sulfatase Antibody (NBP1-90095)(3)

Reviews for Steroid sulfatase Antibody (NBP1-90095) (0)

There are no reviews for Steroid sulfatase Antibody (NBP1-90095). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Steroid sulfatase Antibody (NBP1-90095) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Steroid sulfatase Products

Bioinformatics Tool for Steroid sulfatase Antibody (NBP1-90095)

Discover related pathways, diseases and genes to Steroid sulfatase Antibody (NBP1-90095). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Steroid sulfatase Antibody (NBP1-90095)

Discover more about diseases related to Steroid sulfatase Antibody (NBP1-90095).
 

Pathways for Steroid sulfatase Antibody (NBP1-90095)

View related products by pathway.

PTMs for Steroid sulfatase Antibody (NBP1-90095)

Learn more about PTMs related to Steroid sulfatase Antibody (NBP1-90095).
 

Research Areas for Steroid sulfatase Antibody (NBP1-90095)

Find related products by research area.

Blogs on Steroid sulfatase

There are no specific blogs for Steroid sulfatase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Steroid sulfatase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol STS