Corticotropin Releasing Factor Antibody (2B11)

Images

 
Western Blot: Corticotropin Releasing Factor Antibody (2B11) [H00001392-M02] - Analysis of CRH expression in transfected 293T cell line by CRH monoclonal antibody (M02), clone 2B11.Lane 1: CRH transfected lysate(21.4 ...read more
Sandwich ELISA: Corticotropin Releasing Factor Antibody (2B11) [H00001392-M02] - Detection limit for recombinant GST tagged CRH is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2B11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Corticotropin Releasing Factor Antibody (2B11) Summary

Immunogen
CRH (AAH11031 154 a.a. - 196 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEIIGK
Specificity
CRH (2B11)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CRH
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publications using H00001392-M02.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Corticotropin Releasing Factor Antibody (2B11)

  • corticoliberin
  • corticotropin releasing hormone
  • Corticotropin-releasing hormone
  • CRFCorticotropin-releasing factor

Background

Corticotropin-releasing hormone (CRH) is a 41-amino acid peptide derived from a 191-amino acid preprohormone. CRH is secreted by the paraventricular nucleus (PVN) of the hypothalamus in response to stress. Marked reduction in CRH has been observed in association with Alzheimer disease and autosomal recessive hypothalamic corticotropin dificiency has multiple and potentially fatal metabolic consequences including hypoglycemia and hepatitis. In addition to production in the hypothalamus, CRH is also synthesized in peripheral tissues, such as T lymphocytes and is highly expressed in the placenta. In the placenta CRH is a marker that determines the length of gestation and the timing of parturition and delivery. A rapid increase in circulating levels of CRH occurs at the onset of parturition, suggesting that, in addition to its metabolic functions, CRH may act as a trigger for parturition.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1533
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-00175
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-12446
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IM, KD
NBP2-67339
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, IP
MAB7447
Species: Hu
Applications: WB, IHC
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
H00001392-M02
Species: Hu
Applications: WB, ELISA
NBP2-95244
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, KO
NB100-56485
Species: Hu, Mu, Rt, Bv, Ca, Ch
Applications: WB, Simple Western, ICC/IF
NB300-731
Species: Hu, Mu, Rt, Gp, Rb, Sh, Ye
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, B/N
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF1445
Species: Mu, Rt
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-68008
Species: Hu
NBP2-37447
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, IF
7270-IL/CF
Species: Hu
H00001392-M02
Species: Hu
Applications: WB, ELISA

Publications for Corticotropin Releasing Factor Antibody (H00001392-M02)(3)

Reviews for Corticotropin Releasing Factor Antibody (H00001392-M02) (0)

There are no reviews for Corticotropin Releasing Factor Antibody (H00001392-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Corticotropin Releasing Factor Antibody (H00001392-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Corticotropin Releasing Factor Products

Bioinformatics Tool for Corticotropin Releasing Factor Antibody (H00001392-M02)

Discover related pathways, diseases and genes to Corticotropin Releasing Factor Antibody (H00001392-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Corticotropin Releasing Factor Antibody (H00001392-M02)

Discover more about diseases related to Corticotropin Releasing Factor Antibody (H00001392-M02).
 

Pathways for Corticotropin Releasing Factor Antibody (H00001392-M02)

View related products by pathway.

PTMs for Corticotropin Releasing Factor Antibody (H00001392-M02)

Learn more about PTMs related to Corticotropin Releasing Factor Antibody (H00001392-M02).

Blogs on Corticotropin Releasing Factor

There are no specific blogs for Corticotropin Releasing Factor, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Corticotropin Releasing Factor Antibody (2B11) and receive a gift card or discount.

Bioinformatics

Gene Symbol CRH
Entrez
OMIM
Uniprot
COVID-19 update