Corticotropin Releasing Factor Antibody (2B11)


Western Blot: Corticotropin Releasing Factor Antibody (2B11) [H00001392-M02] - Analysis of CRH expression in transfected 293T cell line by CRH monoclonal antibody (M02), clone 2B11.Lane 1: CRH transfected lysate(21.4 more
Sandwich ELISA: Corticotropin Releasing Factor Antibody (2B11) [H00001392-M02] - Detection limit for recombinant GST tagged CRH is 0.3 ng/ml as a capture antibody.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC, IHC-P, S-ELISA

Order Details

Corticotropin Releasing Factor Antibody (2B11) Summary

CRH (AAH11031, 154 a.a. ~ 196 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEIIGK
CRH (2B11)
IgG2a Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Read Publications using H00001392-M02.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
In 1x PBS, pH 7.4
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Corticotropin Releasing Factor Antibody (2B11)

  • corticoliberin
  • corticotropin releasing hormone
  • Corticotropin-releasing hormone
  • CRFCorticotropin-releasing factor


Corticotropin-releasing hormone (CRH) is a 41-amino acid peptide derived from a 191-amino acid preprohormone. CRH is secreted by the paraventricular nucleus (PVN) of the hypothalamus in response to stress. Marked reduction in CRH has been observed in association with Alzheimer disease and autosomal recessive hypothalamic corticotropin dificiency has multiple and potentially fatal metabolic consequences including hypoglycemia and hepatitis. In addition to production in the hypothalamus, CRH is also synthesized in peripheral tissues, such as T lymphocytes and is highly expressed in the placenta. In the placenta CRH is a marker that determines the length of gestation and the timing of parturition and delivery. A rapid increase in circulating levels of CRH occurs at the onset of parturition, suggesting that, in addition to its metabolic functions, CRH may act as a trigger for parturition.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: EnzAct
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IM, IP, KD, WB
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rb, Rt, Xp, Ze
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Species: Bv, Ca, Ch, Hu, Ma, Mu, Rt
Applications: ICC/IF, Simple Western, WB
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA

Publications for Corticotropin Releasing Factor Antibody (H00001392-M02)(3)

Reviews for Corticotropin Releasing Factor Antibody (H00001392-M02) (0)

There are no reviews for Corticotropin Releasing Factor Antibody (H00001392-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Corticotropin Releasing Factor Antibody (H00001392-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Corticotropin Releasing Factor Products

Bioinformatics Tool for Corticotropin Releasing Factor Antibody (H00001392-M02)

Discover related pathways, diseases and genes to Corticotropin Releasing Factor Antibody (H00001392-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Corticotropin Releasing Factor Antibody (H00001392-M02)

Discover more about diseases related to Corticotropin Releasing Factor Antibody (H00001392-M02).

Pathways for Corticotropin Releasing Factor Antibody (H00001392-M02)

View related products by pathway.

PTMs for Corticotropin Releasing Factor Antibody (H00001392-M02)

Learn more about PTMs related to Corticotropin Releasing Factor Antibody (H00001392-M02).

Research Areas for Corticotropin Releasing Factor Antibody (H00001392-M02)

Find related products by research area.

Blogs on Corticotropin Releasing Factor

There are no specific blogs for Corticotropin Releasing Factor, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Corticotropin Releasing Factor Antibody (2B11) and receive a gift card or discount.


Gene Symbol CRH