Oxytocin/Neurophysin I Antibody

Images

 
Immunohistochemistry-Paraffin: Oxytocin/Neurophysin I Antibody [NBP2-68928] - Staining of human skeletal muscle shows no positivity in myocytes as exptected.
Immunohistochemistry-Paraffin: Oxytocin/Neurophysin I Antibody [NBP2-68928] - Staining of human hypothalamus shows strong cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: Oxytocin/Neurophysin I Antibody [NBP2-68928] - Staining of human ovary shows moderate cytoplasmic positivity in follicle cells.
Immunohistochemistry-Paraffin: Oxytocin/Neurophysin I Antibody [NBP2-68928] - Staining of human tonsil shows no positivity in germinal center cells as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Oxytocin/Neurophysin I Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: ICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGS
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OXT
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
Recommended conditions for IHC,Retrieval method: HIER pH6
Control Peptide
Oxytocin/Neurophysin I Recombinant Protein Antigen (NBP2-68928PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for Oxytocin/Neurophysin I Antibody

  • neurophysin I
  • OT
  • OT-NPI
  • OXT
  • OXT-NPI
  • oxytocin, prepro- (neurophysin I)
  • oxytocin, prepropeptide
  • oxytocin-neurophysin 1
  • oxytocin-neurophysin I, preproprotein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-80261
Applications: ELISA
AF009
Species: Hu
Applications: IHC, WB
NBP2-12446
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IM, IP, KD, WB
AF245
Species: Hu
Applications: CyTOF-ready, Flow, WB
H00005498-M01
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, KD, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP2-76347
Species: Hu
Applications: Flow, IHC, IHC-P, PEP-ELISA
AF682
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, WB
H00001392-M02
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
H00005087-M01
Species: Hu, Pm, Mu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
AF6386
Species: Hu
Applications: IP, WB
NBP1-58268
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-67232
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-62664
Species: Hu
Applications: IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
DPG00
Species: Hu
Applications: ELISA
H00008458-M06
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB

Publications for Oxytocin/Neurophysin I Antibody (NBP2-68928) (0)

There are no publications for Oxytocin/Neurophysin I Antibody (NBP2-68928).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Oxytocin/Neurophysin I Antibody (NBP2-68928) (0)

There are no reviews for Oxytocin/Neurophysin I Antibody (NBP2-68928). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Oxytocin/Neurophysin I Antibody (NBP2-68928) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Oxytocin/Neurophysin I Products

Bioinformatics Tool for Oxytocin/Neurophysin I Antibody (NBP2-68928)

Discover related pathways, diseases and genes to Oxytocin/Neurophysin I Antibody (NBP2-68928). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Oxytocin/Neurophysin I Antibody (NBP2-68928)

Discover more about diseases related to Oxytocin/Neurophysin I Antibody (NBP2-68928).
 

Pathways for Oxytocin/Neurophysin I Antibody (NBP2-68928)

View related products by pathway.

PTMs for Oxytocin/Neurophysin I Antibody (NBP2-68928)

Learn more about PTMs related to Oxytocin/Neurophysin I Antibody (NBP2-68928).
 

Research Areas for Oxytocin/Neurophysin I Antibody (NBP2-68928)

Find related products by research area.

Blogs on Oxytocin/Neurophysin I

There are no specific blogs for Oxytocin/Neurophysin I, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Oxytocin/Neurophysin I Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol OXT