| Immunogen | Polyclonal LC3B Antibody was developed against a Recombinant LC3B Protein corresponding to amino acids: MPSEKTFKQRRTFEQRVEDVRLIREQHPTK |
| Predicted Species | Mouse (97%), Rat (97%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MAP1LC3B |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for LC3B Antibody (NBP2-54742)Find related products by research area.
|
|
Autophagy and RAS signaling: Clinical implications By Christina Towers, PhD The cellular recycling process known as autophagy is currently being targeted in over 60 clinical trials focused on treating different types of cancer1. To date, the only autophagy-targeted ... Read full blog post. |
|
Methamphetamine with HIV induces mitochondrial dysfunction and neuronal injury through oxidative stress By Jamshed Arslan, Pharm. D., PhD. December 1 is the World AIDS Day. Despite the combination antiretroviral therapy, 10-25% of Human Immunodeficiency Virus (HIV)-positive individuals report neurocognitive impairm... Read full blog post. |
|
Autophagy and Metastasis By Christina Towers, PhD The majority of cancer patients die from metastatic disease at secondary sites. The threshold to undergo metastasis is high. Only a minority of cancer cells acquire invasive phenotypes... Read full blog post. |
|
Optogenetic Control of Mitophagy: AMBRA1 based mitophagy switch By Christina Towers, PhD Mitophagy in the BrainSelective autophagic degradation of damaged mitochondria, known as mitophagy, has been described as a cyto-protective process. Accordingly, defects in mitophagy h... Read full blog post. |
|
Read full blog post. |
|
Read full blog post. |
|
Read full blog post. |
|
How to visualize autophagy by microscopy By Christina Towers, PhD Autophagy is a recycling process that relies on the formation of a unique organelle termed an autophagosome. An elegant way to monitor autophagy is through various microscopy techniques to... Read full blog post. |
|
Read full blog post. |
|
Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MAP1LC3B |