LC3A Antibody - BSA Free

Images

 
Western Blot: LC3A Antibody [NB100-2331] - High autophagosome concentration is consumed during early immortalized human mesenchymal stem cell differentiation. Immortalized human mesenchymal stem cells were ...read more
Immunocytochemistry/ Immunofluorescence: LC3A Antibody [NB100-2331] - Analysis in PFA fixed NIH/3T3 cells using anti-LC3A antibody. Image from verified customer review.
Immunohistochemistry: LC3A Antibody [NB100-2331] - Staining in mouse meniscus and cartilage. Image from verified customer review.
Western Blot: LC3A Antibody [NB100-2331] - Autophagy mobilized during differentiation of immortalized human mesenchymal stem cells (ihMSCs). Cultured ihMSCs were stimulated to undergo osteogenesis to form osteoblasts ...read more
Western Blot: LC3A Antibody [NB100-2331] - This LC3A antibody Image shows Analysis in human cell lysates.
Western Blot: LC3A Antibody [NB100-2331] - This LC3A antibody Image shows analysis of heart tissue lysates from mice which were subjected or not to 48 hours of starvation. The signal was developed using ECL method and ...read more
Western Blot: LC3A Antibody [NB100-2331] - Detection of HRP conjugated autophagic LC3 in mouse ES cell lysate. The atg5-/- lane (ES cells, cultured to form embryonic bodies, that are deficient in conversion of LC3-1 to ...read more
Immunocytochemistry/ Immunofluorescence: LC3A Antibody [NB100-2331] - This LC3A antibody Image shows an analysis in HeLa cells using anti-LC3 antibody (red). Nuclei were counterstained with DAPI (blue).
Immunocytochemistry/ Immunofluorescence: LC3A Antibody [NB100-2331] - Left panel shows untreated HeLa cells. Right panel shows HeLa cells that were treated with 50 uM CQ overnight. Cells were fixed for 10 minutes using ...read more
Immunohistochemistry: LC3A Antibody [NB100-2331] - Rapamycin increases autophagy in brains of PDAPP mice. Representative epifluorescent (c200x) image of hippocampal CA1 in control- and rapamycin-fed transgenic PDAPP ...read more
Immunohistochemistry: LC3A Antibody [NB100-2331] - Analysis in mouse renal tissue. Image from verifed customer review.
Simple Western: LC3A Antibody [NB100-2331] - Image shows a specific band for LC3 in 0.5 mg/mL of Neuro2A lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Product Details

Summary
Reactivity Hu, Mu, Rt, Am, Ca, Fi, Pl, Ze, BvSpecies Glossary
Applications WB, Simple Western, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, SB, IHC-WhMt
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Concentration
1.0 mg/ml

Order Details

LC3A Antibody - BSA Free Summary

Immunogen
This LC3A Antibody was prepared from a synthetic peptide made to an internal portion of the human LC3 protein sequence (between residues 25-121). [Uniprot: Q9H492].
Localization
LC3-I is cytoplasmic. LC3-II binds to the autophagic membranes.
Marker
Autophagosome Marker
Specificity
This LC3A Antibody detects both LC3A and LC3B.
Predicted Species
Bovine (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAP1LC3A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Chromatin Immunoprecipitation
  • ELISA
  • Flow Cytometry
  • Immunoblotting
  • Immunocytochemistry/Immunofluorescence 1:100-1:300
  • Immunohistochemistry Whole-Mount
  • Immunohistochemistry 1:200-1:400
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin 1:200-1:400
  • Immunoprecipitation 20 ug / 500 ug of lysate
  • Simple Western 1:50
  • Southern Blot
  • Western Blot 2.0 ug/ml
Application Notes
Western blot bands are seen at ~19 kDa, representing LC3-I, and ~17 kDa, representing LC3-II. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. In ICC, cytoplasmic staining was observed in HeLa cells. Use in immunocytochemistry (PMID: 21545732). and Immunohistochemistry-Paraffin (PMID: 26571030). reported in scientific literature. Use in Flow cytometry reported in scientific literature ( PMID: 24419333).. Use in ELISA reported in scientific literature (PMID: 20930550).. Use in Immunohistochemistry-Whole mount reported in scientific literature (PMID: 31783118).. Use in Southern blot reported in scientific literature (PMID: 21262964).. Use in immunoblotting reported in scientific literature (PMID: 28253371).. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Use in Chromatin Immunoprecipitation reported in scientific literature (PMID:33035707).
Control
Mouse Brain Whole Tissue Lysate (Adult Whole Normal)
Human Brain Whole Tissue Lysate (Adult Whole Normal)
Neuro2a Whole Cell Lysate
Neuro2a Chloroquine Treated / Untreated Cell Lysate
HeLa Chloroquine Treated / Untreated Cell Lysate
Reviewed Applications
Read 22 Reviews rated 4.3
using
NB100-2331 in the following applications:

Publications
Read Publications using
NB100-2331 in the following applications:

Reactivity Notes

Use in Rat reported in scientific literature (PMID:33678798). Use in Amphibian reported in scientific literature (PMID:29777142).

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS
Preservative
0.02% Sodium Azide
Concentration
1.0 mg/ml
Purity
Immunogen affinity purified

Alternate Names for LC3A Antibody - BSA Free

  • Apg8
  • APG8a
  • Apg8p3
  • ATG8E
  • Autophagy-related protein LC3 A
  • Autophagy-related ubiquitin-like modifier LC3 A
  • LC3
  • LC3A
  • MAP1 light chain 3-like protein 1
  • MAP1A/1B light chain 3 A
  • MAP1A/MAP1B LC3 A
  • MAP1A/MAP1B light chain 3 A
  • MAP1ALC3
  • MAP1BLC3
  • MAP1LC3A
  • Microtubule-associated protein 1 light chain 3 alpha
  • microtubule-associated proteins 1A/1B light chain 3
  • microtubule-associated proteins 1A/1B light chain 3A
  • MLP3A

Background

Human Microtubule-associated Protein 1A/1B Light Chain 3A (MAP1LC3A), also called LC3A for short, is a 121 amino acid (aa) protein with a theoretic molecular weight of ~14 kDa. LC3A belongs to the LC3 subfamily of Autophagy-related 8 (Atg8) proteins, which also includes LC3B and LC3C (1). The process of autophagy is the bulk degradation of proteins and organelles. Whether these three proteins have distinct roles in autophagy remains unclear, but they do have unique subcellular expression (2). Specifically, LC3A shows perinuclear and nuclear localization (2). The Atg8 family members share a similar structure of two amino-terminal alpha-helices and a ubiquitin-like core but are unique in aa sequence (1). LC3 utilizes a ubiquitin-like conjugation system to covalently bind to phosphatidylethanolamine (PE), also called lipidation, which is mediated by a series of steps (1, 3). Briefly, unprocessed, cytosolic LC3 (pro-LC3) is cleaved by the cysteine protease Atg4 to expose a c-terminal glycine (Gly) residue (LC3-I); the Gly is activated by E1-like enzyme Atg7, transferred to E2-like enzyme Atg3, and an E3-like complex facilitates the conjugation of LC3 with PE (LC3-II), incorporating it into the phagophore membrane during autophagosome formation (1, 3). The recruitment of LC3 to the phagophore is thought to mediate membrane elongation and closure (1, 3). Additionally, LC3 plays a role in recruiting cargo (protein aggregates, pathogens, and organelles) to autophagosomes and delivery for lysosomal degradation (1).

The process of autophagy is associated with a variety of diseases including neurodegenerative diseases, neuromuscular, tumorigenesis, and viral and bacterial infections (4). LC3 is a useful marker of autophagy in both healthy and diseased cells (4). Interestingly, LC3A has two variants (v1 and v2) which differ in N-terminal sequence due to the varying transcriptional start sites (5). One particular study found that LC3Av1, but not v2 or LC3B, was silenced in various cancer cell lines due to aberrant DNA methylation and re-expression of LC3Av1 in LC3Av1-silenced cells inhibited tumor growth, where overall findings suggest a possible tumor-suppressive role (5).

Alternative names for LC3A include Apg8, APG8a, ATG8E, Autophagy-related protein LC3 A, Autophagy-related ubiquitin-like modifier LC3 A, MAP1A/1B light chain 3 A, microtubule-associated proteins 1A/1B light chain 3, and MLP3A.

References

1. Shpilka, T., Weidberg, H., Pietrokovski, S., & Elazar, Z. (2011). Atg8: an autophagy-related ubiquitin-like protein family. Genome biology. https://doi.org/10.1186/gb-2011-12-7-226

2. Koukourakis, M. I., Kalamida, D., Giatromanolaki, A., Zois, C. E., Sivridis, E., Pouliliou, S., Mitrakas, A., Gatter, K. C., & Harris, A. L. (2015). Autophagosome Proteins LC3A, LC3B and LC3C Have Distinct Subcellular Distribution Kinetics and Expression in Cancer Cell Lines. PloS one. https://doi.org/10.1371/journal.pone.0137675

3. Weidberg, H., Shvets, E., & Elazar, Z. (2011). Biogenesis and cargo selectivity of autophagosomes. Annual review of biochemistry. https://doi.org/10.1146/annurev-biochem-052709-094552

4. Tanida, I., Ueno, T., & Kominami, E. (2004). LC3 conjugation system in mammalian autophagy. The international journal of biochemistry & cell biology. https://doi.org/10.1016/j.biocel.2004.05.009

5. Schaaf, M. B., Keulers, T. G., Vooijs, M. A., & Rouschop, K. M. (2016). LC3/GABARAP family proteins: autophagy-(un)related functions. FASEB journal : official publication of the Federation of American Societies for Experimental Biology. https://doi.org/10.1096/fj.201600698R

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00008878-M01
Species: Bv, Ha, Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB500-249
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
H00002965-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, S-ELISA, WB
NBP1-31381
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-37399
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-02627
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-19151
Species: Bv, Hu, Ma
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB600-607
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
NB110-53818
Species: Al, Bv, Dr, Fi, Gp, Hu, Mu, Po, Pm, Rt, Xp, Ze
Applications: EM, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, KO, PLA, RIA, Simple Western, WB
NBP2-82090
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-55202
Species: Hu
Applications: IHC, IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
MAB6608
Species: Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
NBP2-52721
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

Publications for LC3A Antibody (NB100-2331)(278)

We have publications tested in 8 confirmed species: Human, Mouse, Rat, Amphibian, Canine, Fish, Plant, Zebrafish.

We have publications tested in 13 applications: ChIP, ELISA, FLOW, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-WhMt, IP, WB, WB,IP.


Filter By Application
ChIP
(1)
ELISA
(2)
FLOW
(1)
Flow
(1)
IB
(1)
ICC/IF
(37)
IHC
(10)
IHC-Fr
(6)
IHC-P
(5)
IHC-WhMt
(1)
IP
(3)
WB
(168)
WB,IP
(1)
All Applications
Filter By Species
Human
(93)
Mouse
(76)
Rat
(14)
Amphibian
(2)
Canine
(2)
Fish
(2)
Plant
(1)
Zebrafish
(9)
All Species
Showing Publications 1 - 10 of 278. Show All 278 Publications.
Publications using NB100-2331 Applications Species
Record M, Attia M, Carayon K et al. Targeting the liver X receptor with dendrogenin A differentiates tumour cells to secrete immunogenic exosome-enriched vesicles Journal of extracellular vesicles [PMID: 35411723] (ICC/IF, Human, Mouse) ICC/IF Human, Mouse
Zhang R, Varela M, Forn-CunI G et al. Deficiency in the autophagy modulator Dram1 exacerbates pyroptotic cell death of Mycobacteria-infected macrophages Cell Death Dis Apr 24 2020 [PMID: 32332700] (WB, Zebrafish) WB Zebrafish
Fedele A, Proud C Chloroquine and bafilomycin A mimic lysosomal storage disorders and impair mTORC1 signalling. Biosci Rep. 2020 Apr 30 [PMID: 32285908] (WB, Human) WB Human
Li W, Dai Y, Shi B et Al. LRPPRC sustains Yap-P27-mediated cell ploidy and P62-HDAC6-mediated autophagy maturation and suppresses genome instability and hepatocellular carcinomas Oncogene Mar 16 2020 [PMID: 32203162] (Mouse) Mouse
Szekerczes T, Gogl A, Illyes I et Al. Autophagy, Mitophagy and MicroRNA Expression in Chronic Hepatitis C and Autoimmune Hepatitis Pathol. Oncol. Res. Mar 2 2020 [PMID: 32124227] (IHC-P, Human) IHC-P Human
Cai K Altered expression levels of autophagy-associated proteins during exercise preconditioning indicate the involvement of autophagy in cardioprotection against exercise-induced myocardial injury J Physiol Sci Feb 17 2020 [PMID: 32066368] (IHC, Rat) IHC Rat
Lindahl M, Chalazonitis A, Palm E et al. Cerebral dopamine neurotrophic factor-deficiency leads to degeneration of enteric neurons and altered brain dopamine neuronal function in mice Neurobiol Dis. Nov 26 2019 [PMID: 31783118] (IHC-WhMt, Mouse) IHC-WhMt Mouse
Sarnyai F, SzekerczEs T, Csala M et al. BGP-15 Protects Mitochondria in Acute, Acetaminophen Overdose Induced Liver Injury Pathol. Oncol. Res. Nov 8 2019 [PMID: 31705481] (IHC-P, Mouse) IHC-P Mouse
Bryant J, Batis N, Franke AC et al. Repurposed quinacrine synergizes with cisplatin, reducing the effective dose required for treatment of head and neck squamous cell carcinoma Oncotarget Aug 27 2019 [PMID: 31497252] (WB, Human) WB Human
Ding Y, Dvornikov AV, Ma X et al. Haploinsufficiency of mechanistic target of rapamycin ameliorates bag3 cardiomyopathy in adult zebrafish Dis Model Mech Sep 6 2019 [PMID: 31492659] (WB, Zebrafish) WB Zebrafish
Show All 278 Publications.

Reviews for LC3A Antibody (NB100-2331) (22) 4.322

Average Rating: 4.3
(Based on 22 reviews)
We have 22 reviews tested in 5 species: Human, Mouse, Rat, Human and Mouse, Other.

Reviews using NB100-2331:
Filter by Applications
Immunocytochemistry
(1)
Western Blot
(18)
Immunofluorescence
(1)
Immunohistochemistry-Paraffin
(1)
Immunohistochemistry
(1)
All Applications
Filter by Species
Human
(10)
Mouse
(8)
Rat
(1)
Human and Mouse
(1)
Other
(1)
All Species
Images Ratings Applications Species Date Details
Immunocytochemistry LC3A NB100-2331
Enlarge
4
reviewed by:
Lucia Lisi
Immunocytochemistry Human 05/21/2021
View

Summary

ApplicationImmunocytochemistry
Sample TestedHuman microglia cell lysate,Human microglia
SpeciesHuman
LotAK
Western Blot LC3A NB100-2331
Enlarge
4
reviewed by:
Lucia Lisi
Western Blot Rat 05/21/2021
View

Summary

ApplicationWestern Blot
Sample TestedMICROGLIA
SpeciesRat
LotAK
Western Blot LC3A NB100-2331
Enlarge
5
reviewed by:
Eric Wang
Western Blot Human 06/09/2020
View

Summary

ApplicationWestern Blot
Sample TestedTHP-1 cell lysate
SpeciesHuman
LotAB-3

Comments

CommentsThe antibody works great to detect the LC3 from THP-1 cell lysates
Western Blot LC3A NB100-2331
Enlarge
4
reviewed by:
Marie Lassont
Western Blot Mouse 01/29/2019
View

Summary

ApplicationWestern Blot
Sample Testedlysed cell lines, Sample Amount: 20 ug
SpeciesMouse
LotA6-NB100-2331
Western Blot LC3A NB100-2331
Enlarge
4
reviewed by:
Liyong Zhang
Western Blot Human and Mouse 11/25/2017
View

Summary

ApplicationWestern Blot
Sample Testedmouse hepatocytes and HepG2 cells
SpeciesHuman and Mouse
LotAC-1
Western Blot LC3A NB100-2331
Enlarge
5
reviewed by:
Du Jiuju
Western Blot Mouse 08/07/2017
View

Summary

ApplicationWestern Blot
Sample TestedMouse macrophage cell line RAW 264.7
SpeciesMouse
LotH6-NB100-2331
  5
reviewed by:
Verified Customer
Western Blot Mouse 10/06/2015
View

Summary

ApplicationWestern Blot
Sample TestedMouse Neuro2A, Mouse Cortical Neurons whole cell lysate
SpeciesMouse
LotR-4
Western Blot LC3A NB100-2331
Enlarge
5
reviewed by:
Ilya Ulasov
Western Blot Human 01/12/2015
View

Summary

ApplicationWestern Blot
Sample Testedhuman glioblastoma
SpeciesHuman
  4
reviewed by:
cynthia morimoto
Western Blot Mouse 12/12/2014
View

Summary

ApplicationWestern Blot
Sample TestedSee PMID 22892563
SpeciesMouse
Immunofluorescence LC3A NB100-2331
Enlarge
5
reviewed by:
Bindi Patel
Immunofluorescence Mouse 11/25/2014
View

Summary

ApplicationImmunofluorescence
Sample TestedNIH3T3, HeLa, HEK293T, N2a neuroblastoma, Q7 striatal, Sy5Y neuroblastoma
SpeciesMouse
Immunohistochemistry-Paraffin LC3A NB100-2331
Enlarge
4
reviewed by:
Verified Customer
Immunohistochemistry-Paraffin 10/04/2014
View

Summary

ApplicationImmunohistochemistry-Paraffin
LotS-1
Western Blot LC3A NB100-2331
Enlarge
4
reviewed by:
Verified Customer
Western Blot Human 06/30/2014
View

Summary

ApplicationWestern Blot
Sample Testedhuman tumor cells
SpeciesHuman
Lotq-1
  4
reviewed by:
Fabio Di Domenico
Western Blot Human 06/20/2014
View

Summary

ApplicationWestern Blot
SpeciesHuman
Western Blot LC3A NB100-2331
Enlarge
3
reviewed by:
Verified Customer
Western Blot Human 04/02/2014
View

Summary

ApplicationWestern Blot
SpeciesHuman
LotS-2
Immunohistochemistry LC3A NB100-2331
Enlarge
4
reviewed by:
Verified Customer
Immunohistochemistry Mouse 08/13/2012
View

Summary

ApplicationImmunohistochemistry
Sample TestedRenal tissue (paraffin block)
SpeciesMouse
LotN
Western Blot LC3A NB100-2331
Enlarge
4
reviewed by:
Jay Kao
Western Blot Human 12/28/2011
View

Summary

ApplicationWestern Blot
Sample TestedHuman
SpeciesHuman
  5
reviewed by:
Ming-Tsang Chiao
Western Blot Human 11/21/2011
View

Summary

ApplicationWestern Blot
Sample TestedHuman
SpeciesHuman
  5
reviewed by:
Ming-Shiou Jan
Western Blot Human 11/21/2011
View

Summary

ApplicationWestern Blot
Sample TestedHuman
SpeciesHuman
  5
reviewed by:
Che-Hsu Lee
Western Blot Mouse 10/24/2011
View

Summary

ApplicationWestern Blot
Sample TestedMouse
SpeciesMouse
  5
reviewed by:
Verified Customer
Western Blot Mouse 07/08/2010
View

Summary

ApplicationWestern Blot
Sample Tested3T3-L1 adipocyte, Sample Amount: 30ug
SpeciesMouse
LotH2
  3
reviewed by:
System Admin
Western Blot Other 11/05/2009
View

Summary

ApplicationWestern Blot
Sample Testedlysed cell lines, Sample Amount: 20 ug
SpeciesOther
LotJ
  4
reviewed by:
System Admin
Western Blot Human 02/18/2009
View

Summary

ApplicationWestern Blot
Sample TestedHuman cancer cells, Sample Amount: 80ug
SpeciesHuman
LotSS

Product General Protocols

Video Protocols

WB Video Protocol
ChIP Video Protocol
ChIP Webinar
ICC/IF Video Protocol

FAQs for LC3A Antibody (NB100-2331). (Showing 1 - 3 of 3 FAQs).

  1. May we ask if it is possible to perform IF to stain LC3-I and LC3-II separately with two different fluorescent colors?
    • Yes, it is possible to perform IF stain for LC3-I and LC3-II separately with two different fluorescent colors! You will have to use two different primary antibodies and in order to avoid any potential background/cross reactivity issues, I would suggest that you employ conjugated primary antibodies for the testing. 1. Our LC3I antibody (NBP1-78964) has been designed to specifically detect the cytosolic form of the LC3 protein which is actually LC3 I (Note: LC3-II binds to the autophagic membranes). 2. There is not even a single antibody to our knowledge that would exclusively detect the LC3 II form, and you would have to detect LC3II/ autophagic membranes form with an antibody which detects LC3 I/LC3II together. Therefore you may opt second antibody from one of the followings: LC3 Antibody (NB100-2220), LC3 Antibody (NB100-2331), LC3 Antibody (NBP1-19167). All of these mentioned catalog #s come with different options for their conjugated forms and you may select appropriate conjugated forms for performing the IF staining using our explained criteria.
  2. I am interested in detecting the LC3 protein in the sea anemone Aiptasia. I have used your LC3 antibody (NB100-2331) and got a band in my Western blot at around 15 kD, which seems reasonable. However I would like to know how likely it is that your antibody binds to the LC3 protein of Aiptasia? Unfortunately I could not find the protein sequence against which the LC3 antibody was raised to and am hoping you could help me. The protein sequence for the Aiptasia LC3 is: MGDNNVLSYKPFKQRKSFVSRRDEVAGIRAKFPSKVPVIVERYHKERDLPLLDKTKFLVPQELTMSQFVTIIRNRMSLSS TQAFYLIVNNKSLASMSMTMAELYREEKDEDGFLYMVYASQEMFGCNS
    • In comparing the sequences of the human LC3 and Aiptasia proteins, and it seems as though there is very low homology. There is only 62% sequence similarity, and we generally don't recommend antibodies for novel species unless they have at least 85%. There is a chance that it will work, but we cannot guarantee it.
  3. Do you have any data or reason to believe the your LC3 antibody (NB100-2331) has a higher affinity to LC3-II than to LC3-I?
    • No, we do not have any data or reason to believe that NB100-2331 has a higher affinity to LC3-II than to LC3-I. This antibody was raised using a synthetic peptide made to an internal portion of the human LC3 protein sequence (between residues 25-121) as an immunogen and is expected to detect both LC3-I as well as LC3-II, and their signal will depend upon their respective amounts being present in your samples at the time of detection.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional LC3A Products

Bioinformatics Tool for LC3A Antibody (NB100-2331)

Discover related pathways, diseases and genes to LC3A Antibody (NB100-2331). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LC3A Antibody (NB100-2331)

Discover more about diseases related to LC3A Antibody (NB100-2331).
 

Pathways for LC3A Antibody (NB100-2331)

View related products by pathway.

PTMs for LC3A Antibody (NB100-2331)

Learn more about PTMs related to LC3A Antibody (NB100-2331).
 

Research Areas for LC3A Antibody (NB100-2331)

Find related products by research area.

Blogs on LC3A.

The LC3 A, B, C’s and 1, 2, 3’s
By Christina Towers, PhD Autophagy is a catabolic process used to breakdown and recycle damaged proteins and organelles. It is a multistep process that, in its simplest form, consists of 4 steps: initiation, phago...  Read full blog post.

Losing memory: Toxicity from mutant APP and amyloid beta explain the hippocampal neuronal damage in Alzheimer's disease
 By Jamshed Arslan Pharm.D.  Alzheimer's disease (AD) is an irreversible brain disorder that destroys memory and thinking skills. The telltale signs of AD brains are extracellular deposits of amy...  Read full blog post.

Nuclear LC3: Why is it there and what is it doing?
By Christina Towers, PhD. Cells use the complex process of autophagy to degrade and recycle cytoplasmic material.  There are over 20 proteins that have been implicated in this process and appropriately named core ...  Read full blog post.

Why LC3B Antibodies Make Ideal Autophagosomes Membrane Markers
The human form of microtubule-associated protein light chain 3 (LC3) is expressed as 3 splice variants LC3A, LC3B, and LC3C.1 LC3B is a subunit of the MAP1A and MAP1B microtubule-binding proteins and plays a central role in autophagosome membrane stru...  Read full blog post.

Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4.3
5
9
4
11
3
2
2
0
1
0

Lucia Lisi
05/21/2021
Application: Immunocytochemistry
Species: Human

Lucia Lisi
05/21/2021
Application: Western Blot
Species: Rat

Eric Wang
06/09/2020
Application: Western Blot
Species: Human

Bioinformatics

Gene Symbol MAP1LC3A