LC3A Antibody

Images

 
Western Blot: LC3A Antibody [NB100-2331] - High autophagosome concentration is consumed during early immortalized human mesenchymal stem cell differentiation. Immortalized human mesenchymal stem cells were ...read more
Immunocytochemistry/ Immunofluorescence: LC3A Antibody [NB100-2331] - Analysis in PFA fixed NIH/3T3 cells using anti-LC3A antibody. Image from verified customer review.
Immunohistochemistry: LC3A Antibody [NB100-2331] - Staining in mouse meniscus and cartilage. Image from verified customer review.
Western Blot: LC3A Antibody [NB100-2331] - Autophagy mobilized during differentiation of immortalized human mesenchymal stem cells (ihMSCs). Cultured ihMSCs were stimulated to undergo osteogenesis to form osteoblasts ...read more
Western Blot: LC3A Antibody [NB100-2331] - This LC3A antibody Image shows Analysis in human cell lysates.
Western Blot: LC3A Antibody [NB100-2331] - This LC3A antibody Image shows analysis of heart tissue lysates from mice which were subjected or not to 48 hours of starvation. The signal was developed using ECL method and ...read more
Western Blot: LC3A Antibody [NB100-2331] - Detection of HRP conjugated autophagic LC3 in mouse ES cell lysate. The atg5-/- lane (ES cells, cultured to form embryonic bodies, that are deficient in conversion of LC3-1 to ...read more
Immunocytochemistry/ Immunofluorescence: LC3A Antibody [NB100-2331] - This LC3A antibody Image shows an analysis in HeLa cells using anti-LC3 antibody (red). Nuclei were counterstained with DAPI (blue).
Immunocytochemistry/ Immunofluorescence: LC3A Antibody [NB100-2331] - Left panel shows untreated HeLa cells. Right panel shows HeLa cells that were treated with 50 uM CQ overnight. Cells were fixed for 10 minutes using ...read more
Immunohistochemistry: LC3A Antibody [NB100-2331] - Rapamycin increases autophagy in brains of PDAPP mice. Representative epifluorescent (c200x) image of hippocampal CA1 in control- and rapamycin-fed transgenic PDAPP ...read more
Immunohistochemistry: LC3A Antibody [NB100-2331] - Analysis in mouse renal tissue. Image from verifed customer review.
Simple Western: LC3A Antibody [NB100-2331] - Image shows a specific band for LC3 in 0.5 mg/mL of Neuro2A lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Product Details

Summary
Reactivity Hu, Mu, Rt, Ca, Fi, Pl, Ze, BvSpecies Glossary
Applications WB, Simple Western, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, SB, IHC-WhMt
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
1.0 mg/ml

LC3A Antibody Summary

Immunogen
This LC3A Antibody was prepared from a synthetic peptide made to an internal portion of the human LC3 protein sequence (between residues 25-121). [Uniprot: Q9H492].
Localization
LC3-I is cytoplasmic. LC3-II binds to the autophagic membranes.
Marker
Autophagosome Marker
Specificity
This LC3A Antibody detects both LC3A and LC3B.
Predicted Species
Bovine (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAP1LC3A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Simple Western 1:50
  • ELISA
  • Flow Cytometry
  • Immunoblotting
  • Immunocytochemistry/Immunofluorescence 1:100-1:300
  • Immunohistochemistry 1:200-1:400
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin 1:200-1:400
  • Immunoprecipitation 20 ug / 500 ug of lysate
  • Southern Blot
  • Immunohistochemistry Whole-Mount
Application Notes
Western blot bands are seen at ~19 kDa, representing LC3-I, and ~17 kDa, representing LC3-II. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. In ICC, cytoplasmic staining was observed in HeLa cells. Use in immunocytochemistry (PMID: 21545732) and Immunohistochemistry-Paraffin (PMID: 26571030) reported in scientific literature. Use in Flow cytometry reported in scientific literature ( PMID: 24419333). Use in ELISA reported in scientific literature (PMID: 20930550). Use in Immunohistochemistry-Whole mount reported in scientific literature (PMID: 31783118). Use in Southern blot reported in scientific literature (PMID: 21262964). Use in immunoblotting reported in scientific literature (PMID: 28253371). In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
Control
LC3B Overexpression Lysate
Mouse Brain Whole Tissue Lysate (Adult Whole Normal)
Human Brain Whole Tissue Lysate (Adult Whole Normal)
Neuro2a Whole Cell Lysate
Neuro2a Chloroquine Treated / Untreated Cell Lysate
HeLa Chloroquine Treated / Untreated Cell Lysate
Reviewed Applications
Read 20 Reviews rated 4.4
using
NB100-2331 in the following applications:

Publications
Read Publications using
NB100-2331 in the following applications:

Reactivity Notes

Fish reactivity reported in scientific literature (PMID: 25522711). Canine reactivity reported in scientific literature (PMID: 26179070). Plant reactivity reported in scientific literature (PMID: 27861739).

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS
Preservative
0.02% Sodium Azide
Concentration
1.0 mg/ml
Purity
Immunogen affinity purified

Alternate Names for LC3A Antibody

  • Apg8
  • APG8a
  • Apg8p3
  • ATG8E
  • Autophagy-related protein LC3 A
  • Autophagy-related ubiquitin-like modifier LC3 A
  • LC3
  • LC3A
  • MAP1 light chain 3-like protein 1
  • MAP1A/1B light chain 3 A
  • MAP1A/MAP1B LC3 A
  • MAP1A/MAP1B light chain 3 A
  • MAP1ALC3
  • MAP1BLC3
  • MAP1LC3A
  • Microtubule-associated protein 1 light chain 3 alpha
  • microtubule-associated proteins 1A/1B light chain 3
  • microtubule-associated proteins 1A/1B light chain 3A
  • MLP3A

Background

Human Microtubule-associated Protein 1A/1B Light Chain 3A (MAP1LC3A), also called LC3A for short, is a 121 amino acid (aa) protein with a theoretic molecular weight of ~14 kDa. LC3A belongs to the LC3 subfamily of Autophagy-related 8 (Atg8) proteins, which also includes LC3B and LC3C (1). The process of autophagy is the bulk degradation of proteins and organelles. Whether these three proteins have distinct roles in autophagy remains unclear, but they do have unique subcellular expression (2). Specifically, LC3A shows perinuclear and nuclear localization (2). The Atg8 family members share a similar structure of two amino-terminal alpha-helices and a ubiquitin-like core but are unique in aa sequence (1). LC3 utilizes a ubiquitin-like conjugation system to covalently bind to phosphatidylethanolamine (PE), also called lipidation, which is mediated by a series of steps (1, 3). Briefly, unprocessed, cytosolic LC3 (pro-LC3) is cleaved by the cysteine protease Atg4 to expose a c-terminal glycine (Gly) residue (LC3-I); the Gly is activated by E1-like enzyme Atg7, transferred to E2-like enzyme Atg3, and an E3-like complex facilitates the conjugation of LC3 with PE (LC3-II), incorporating it into the phagophore membrane during autophagosome formation (1, 3). The recruitment of LC3 to the phagophore is thought to mediate membrane elongation and closure (1, 3). Additionally, LC3 plays a role in recruiting cargo (protein aggregates, pathogens, and organelles) to autophagosomes and delivery for lysosomal degradation (1).

The process of autophagy is associated with a variety of diseases including neurodegenerative diseases, neuromuscular, tumorigenesis, and viral and bacterial infections (4). LC3 is a useful marker of autophagy in both healthy and diseased cells (4). Interestingly, LC3A has two variants (v1 and v2) which differ in N-terminal sequence due to the varying transcriptional start sites (5). One particular study found that LC3Av1, but not v2 or LC3B, was silenced in various cancer cell lines due to aberrant DNA methylation and re-expression of LC3Av1 in LC3Av1-silenced cells inhibited tumor growth, where overall findings suggest a possible tumor-suppressive role (5).

Alternative names for LC3A include Apg8, APG8a, ATG8E, Autophagy-related protein LC3 A, Autophagy-related ubiquitin-like modifier LC3 A, MAP1A/1B light chain 3 A, microtubule-associated proteins 1A/1B light chain 3, and MLP3A.

References

1. Shpilka, T., Weidberg, H., Pietrokovski, S., & Elazar, Z. (2011). Atg8: an autophagy-related ubiquitin-like protein family. Genome biology. https://doi.org/10.1186/gb-2011-12-7-226

2. Koukourakis, M. I., Kalamida, D., Giatromanolaki, A., Zois, C. E., Sivridis, E., Pouliliou, S., Mitrakas, A., Gatter, K. C., & Harris, A. L. (2015). Autophagosome Proteins LC3A, LC3B and LC3C Have Distinct Subcellular Distribution Kinetics and Expression in Cancer Cell Lines. PloS one. https://doi.org/10.1371/journal.pone.0137675

3. Weidberg, H., Shvets, E., & Elazar, Z. (2011). Biogenesis and cargo selectivity of autophagosomes. Annual review of biochemistry. https://doi.org/10.1146/annurev-biochem-052709-094552

4. Tanida, I., Ueno, T., & Kominami, E. (2004). LC3 conjugation system in mammalian autophagy. The international journal of biochemistry & cell biology. https://doi.org/10.1016/j.biocel.2004.05.009

5. Schaaf, M. B., Keulers, T. G., Vooijs, M. A., & Rouschop, K. M. (2016). LC3/GABARAP family proteins: autophagy-(un)related functions. FASEB journal : official publication of the Federation of American Societies for Experimental Biology. https://doi.org/10.1096/fj.201600698R

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00008878-M01
Species: Hu, Mu, Rt, Bv, Ha, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, S-ELISA
NB500-249
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD
H00002965-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RNAi, S-ELISA
NBP1-31381
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-37399
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-02627
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-19151
Species: Hu, Bv, Ma
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB600-607
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NB110-53818
Species: Hu, Mu, Rt, Po, Bv, Fi, Gp, Pm, Xp, Ze
Applications: WB, Simple Western, EM, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, PLA, RIA, KD, KO
NBP2-82090
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-55202
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, Ch, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, HEStain, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, IHC-FrFl, KO
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
MAB6608
Species: Hu, Mu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICC, ICFlow
NB100-56098
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
NBP2-67360
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB120-19294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ch, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC

Publications for LC3A Antibody (NB100-2331)(244)

We have publications tested in 7 confirmed species: Human, Mouse, Rat, Canine, Fish, Plant, Zebrafish.

We have publications tested in 11 applications: ELISA, FLOW, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-WhMt, IP, WB, WB,IP.


Filter By Application
ELISA
(2)
FLOW
(1)
IB
(1)
ICC/IF
(32)
IHC
(9)
IHC-Fr
(6)
IHC-P
(4)
IHC-WhMt
(1)
IP
(3)
WB
(147)
WB,IP
(1)
All Applications
Filter By Species
Human
(83)
Mouse
(67)
Rat
(10)
Canine
(1)
Fish
(2)
Plant
(1)
Zebrafish
(9)
All Species
Showing Publications 1 - 10 of 244. Show All 244 Publications.
Publications using NB100-2331 Applications Species
Humphrey SA. DNA damage and oxidative stress induced-p53 activity in astrocytes causes growth arrest. 2012 University of Western Ontario.
Zhang R, Varela M, Forn-CunI G et al. Deficiency in the autophagy modulator Dram1 exacerbates pyroptotic cell death of Mycobacteria-infected macrophages Cell Death Dis Apr 24 2020 [PMID: 32332700] (WB, Zebrafish) WB Zebrafish
Fedele A, Proud C Chloroquine and bafilomycin A mimic lysosomal storage disorders and impair mTORC1 signalling. Biosci Rep. 2020 Apr 30 [PMID: 32285908] (WB, Human) WB Human
Li W, Dai Y, Shi B et Al. LRPPRC sustains Yap-P27-mediated cell ploidy and P62-HDAC6-mediated autophagy maturation and suppresses genome instability and hepatocellular carcinomas Oncogene Mar 16 2020 [PMID: 32203162] (Mouse) Mouse
Szekerczes T, Gogl A, Illyes I et Al. Autophagy, Mitophagy and MicroRNA Expression in Chronic Hepatitis C and Autoimmune Hepatitis Pathol. Oncol. Res. Mar 2 2020 [PMID: 32124227] (IHC-P, Human) IHC-P Human
Cai K Altered expression levels of autophagy-associated proteins during exercise preconditioning indicate the involvement of autophagy in cardioprotection against exercise-induced myocardial injury J Physiol Sci Feb 17 2020 [PMID: 32066368] (IHC, Rat) IHC Rat
Karanasios E, Ktistakis NT. Studying Autophagy: List of Useful Antibodies Produced via a Community Effort. Autophagy at the Cell, Tissue and Organismal Level. 2016 Apr 24
Dong W, Luo Y, Zhang G et al. Carbon Nanospheres Exert Antitumor Effects Associated with Downregulation of 4E-BP1 Expression on Prostate Cancer Int J Nanomedicine Aug 5 2020 [PMID: 32848387] (WB, Human) WB Human
Nettesheim A, Dixon A, Shim MS et al. Autophagy in the Aging and Experimental Ocular Hypertensive Mouse Model Invest. Ophthalmol. Vis. Sci. Aug 3 2020 [PMID: 32797200] (WB, Mouse) WB Mouse
Show All 244 Publications.

Reviews for LC3A Antibody (NB100-2331) (20) 4.420

Average Rating: 4.4
(Based on 20 reviews)
We have 20 reviews tested in 4 species: Human, Mouse, Mouse and Human, Other.

Reviews using NB100-2331:
Filter by Applications
WB
(17)
IF
(1)
IHC-P
(1)
IHC
(1)
All Applications
Filter by Species
Human
(9)
Mouse
(8)
Mouse and Human
(1)
Other
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot LC3A NB100-2331
Enlarge
reviewed by:
Anonymous
WB Human 06/09/2020
View

Summary

ApplicationWestern Blot
Sample TestedTHP-1 cell lysate
SpeciesHuman
LotAB-3

Comments

CommentsThe antibody works great to detect the LC3 from THP-1 cell lysates
Western Blot LC3A NB100-2331
Enlarge
reviewed by:
Anonymous
WB Mouse 01/29/2019
View

Summary

ApplicationWestern Blot
Sample Testedlysed cell lines, Sample Amount: 20 ug
SpeciesMouse
LotA6-NB100-2331
Western Blot LC3A NB100-2331
Enlarge
reviewed by:
Anonymous
WB Mouse and Human 11/25/2017
View

Summary

ApplicationWestern Blot
Sample Testedmouse hepatocytes and HepG2 cells
SpeciesMouse and Human
LotAC-1
Western Blot LC3A NB100-2331
Enlarge
reviewed by:
Anonymous
WB Mouse 08/07/2017
View

Summary

ApplicationWestern Blot
Sample TestedMouse macrophage cell line RAW 264.7
SpeciesMouse
LotH6-NB100-2331
 
reviewed by:
jennifer guadagno
WB Mouse 10/06/2015
View

Summary

ApplicationWestern Blot
Sample TestedMouse Neuro2A, Mouse Cortical Neurons whole cell lysate
SpeciesMouse
LotR-4

Blocking

Blocking Details10% non-fat dry milk in TBS-T (0.05% Tween) for 1hr at room temperature

Primary Anitbody

Dilution Ratio1:1000

Secondary Antibody

Secondary DescriptionGoat-anti rabbit HRP
Secondary Concentration1:5000 in 3% milk in TBS-T (0.05%)

Details

Detection NotesClarity ECL, Biorad Chemidoc imager, exposed for 1 min, Neg control= untreated cells, Pos Control= rapamycin

Comments

CommentsThis antibody works very well. Very strong clear signal.
Western Blot LC3A NB100-2331
Enlarge
reviewed by:
Anonymous
WB Human 01/12/2015
View

Summary

ApplicationWestern Blot
Sample Testedhuman glioblastoma
SpeciesHuman

Blocking

Blocking DetailsLi-Cor blockin bufffer

Primary Anitbody

Dilution Ratio2 ug/ml, overnight, room temperature, TBST buffer

Secondary Antibody

Secondary Descriptionanti-IgG secondary antibodies, Conjugation: IRDye® 800CW
Secondary Manufacturer Cat#Li-Cor
Secondary Concentrationper vendor recomendations

Details

Detection NotesOdyssey Li-Cor

Comments

CommentsPlease site our paper:Tamoxifen improves cytopathic effect of oncolytic adenovirus in primary glioblastoma cells mediated through autophagy." just accepted for Oncotarget.
 
reviewed by:
Anonymous
WB Mouse 12/12/2014
View

Summary

ApplicationWestern Blot
Sample TestedSee PMID 22892563
SpeciesMouse

Blocking

Blocking DetailsSee PMID 22892563

Details

Detection NotesSee PMID 22892563

Comments

CommentsPublished in PMID: 22892563
Immunofluorescence LC3A NB100-2331
Enlarge
reviewed by:
Anonymous
IF Mouse 11/25/2014
View

Summary

ApplicationImmunofluorescence
Sample TestedNIH3T3, HeLa, HEK293T, N2a neuroblastoma, Q7 striatal, Sy5Y neuroblastoma
SpeciesMouse

Blocking

Blocking Details1% BSA + 1%milk

Primary Anitbody

Dilution Ratio1:100 for IF

Secondary Antibody

Secondary DescriptionCy5 conjuagated anti-rabbit
Secondary Concentration1:500

Details

Detection NotesImages taken by Zeiss Axiovert microscope
Fixation DetailsPFA Fixed, 0.1% Tween20 permeabilized, PBS, 1hr primary incubation at RT
Wash DescriptionPBS 3x washes, 2 mins each
Immunohistochemistry-Paraffin LC3A NB100-2331
Enlarge
reviewed by:
Merissa Olmer
IHC-P 10/04/2014
View

Summary

ApplicationImmunohistochemistry-Paraffin
LotS-1
CommentsThese tissue samples were fixed with zinc buffered formalin.
Western Blot LC3A NB100-2331
Enlarge
reviewed by:
Ilya Ulasov
WB Human 06/30/2014
View

Summary

ApplicationWestern Blot
Sample Testedhuman tumor cells
SpeciesHuman
Lotq-1

Blocking

Blocking Details#917-40000, LI-COR

Primary Anitbody

Dilution Ratioin agreement with vendor recommendation

Secondary Antibody

Secondary Descriptiongoat-anti-rabbit
Secondary Manufacturer Cat#Li-COR

Details

Detection NotesOdyssey Imaging System (Model #1866, Li-COR Biosciences
 
reviewed by:
Anonymous
WB Human 06/20/2014
View

Summary

ApplicationWestern Blot
SpeciesHuman
Pub Med ID24735980
FileView PDF
Western Blot LC3A NB100-2331
Enlarge
reviewed by:
Kumsal Tekirdag
WB Human 04/02/2014
View

Summary

ApplicationWestern Blot
SpeciesHuman
LotS-2
Special ApplicationsGives slighter LC3-I band compared to LC3II. Stronger binding to LC3II. High level of background at first usage in BSA solution.
Pub Med ID24358205
FileView PDF
Immunohistochemistry LC3A NB100-2331
Enlarge
reviewed by:
Nirmala Parajuli
IHC Mouse 08/13/2012
View

Summary

ApplicationImmunohistochemistry
Sample TestedRenal tissue (paraffin block)
SpeciesMouse
LotN
CommentsAntibody is good for immunohistochemistry. But, since this is polyclonal, each lot has to be tested for concentration of primary antibody to get desired results.

Blocking

Blocking DetailsProtein block, Dako, 20 min RT

Primary Anitbody

Dilution Ratio1:10,000, 4dC, ON, 0.1%BSA plus0.05% skim milk

Secondary Antibody

Secondary DescriptionGoat anti-rabbit-HRP
Secondary Manufacturer Cat#DAKO, #K4011
Secondary ConcentrationDAKO kit

Details

Detection NotesDAB, 5 min
Fixation Details10% NBF, 10mM Sodium Citrate buffer pH6.0
Wash DescriptionTBS-T, 5 min X 4

Comments

CommentsAntibody is good for immunohistochemistry. But, since this is polyclonal, each lot has to be tested for concentration of primary antibody to get desired results.
Western Blot LC3A NB100-2331
Enlarge
reviewed by:
Anonymous
WB Human 12/28/2011
View

Summary

ApplicationWestern Blot
Sample TestedHuman
SpeciesHuman
CommentsGood antibody!

Blocking

Blocking DetailsBlocking Buffer: 10% non-fat milk

Primary Anitbody

Dilution RatioPrimary Ab Dilution Ratio: 1:1000, Primary Ab Incubation Time: overnight

Secondary Antibody

Secondary DescriptionSecondary Ab: rabbit

Details

Detection NotesDetection Method: HRP

Comments

CommentsGood antibody!
 
reviewed by:
Anonymous
WB Human 11/21/2011
View

Summary

ApplicationWestern Blot
Sample TestedHuman
SpeciesHuman

Blocking

Blocking DetailsBlocking Buffer: 5% Milk

Primary Anitbody

Dilution RatioPrimary Ab Dilution Ratio: 1:1000, Primary Ab Incubation Time: overnight, Primary Ab Incubation Temp: 4 degrees Celsius

Secondary Antibody

Secondary DescriptionSecondary Ab Dilution Ratio: 1:5000

Details

Detection NotesDetection Method: ECL-HRP
 
reviewed by:
Anonymous
WB Human 11/21/2011
View

Summary

ApplicationWestern Blot
Sample TestedHuman
SpeciesHuman

Blocking

Blocking DetailsBlocking Buffer: 2% Skim Milk

Primary Anitbody

Dilution RatioPrimary Ab Dilution Ratio: 1:1000, Primary Ab Incubation Time: overnight, Primary Ab Incubation Temp: 4 degrees Celsius

Secondary Antibody

Secondary DescriptionSecondary Ab: Goat anti-rabbit HRP

Details

Detection NotesDetection Method: ECL
 
reviewed by:
Anonymous
WB Mouse 10/24/2011
View

Summary

ApplicationWestern Blot
Sample TestedMouse
SpeciesMouse
CommentsThe antibody worked well!

Blocking

Blocking DetailsBlocking Buffer: 5% Milk

Primary Anitbody

Dilution RatioPrimary Ab Dilution Ratio: 1:5000, Primary Ab Incubation Time: 16 hours

Secondary Antibody

Secondary DescriptionSecondary Ab: anti-mouse HRP antibody

Details

Detection NotesDetection Method: ECL

Comments

CommentsThe antibody worked well!
 
reviewed by:
Seung-Hyun Ro
WB Mouse 07/08/2010
View

Summary

ApplicationWestern Blot
Sample Tested3T3-L1 adipocyte, Sample Amount: 30ug
SpeciesMouse
LotH2
CommentsI used in for 3T3-L1 mouse adipocyte and it is working great.

Blocking

Blocking DetailsBlocking Buffer: 5% Milk in PBST, Blocking Time: 1 hour, Blocking Temp: Room temperature

Primary Anitbody

Dilution RatioDilution Ratio: 1:1000, Incubation Dilution Buffer: PBST, Incubation Time: 2 hours, Incubation Temp: room temperature

Secondary Antibody

Secondary DescriptionSecondary Ab: Rabbit, Secondary Ab Dilution Ratio: 1:3000
Secondary Manufacturer Cat#Santa Cruz sc-2077

Details

Detection NotesDetection Method: ECL - perkin elmer, Exposure Time: 1 minute, Positive Control: Actin, Specific Bands: 15, 18 kDa

Comments

CommentsI used in for 3T3-L1 mouse adipocyte and it is working great.
Western Blot LC3A NB100-2331
Enlarge
reviewed by:
Anonymous
WB Other 11/05/2009
View

Summary

ApplicationWestern Blot
Sample Testedlysed cell lines, Sample Amount: 20 ug
SpeciesOther
LotJ

Blocking

Blocking DetailsBlocking Buffer: TBS 0.1% Tween20 5% NFDM, Blocking Time: 1 hour, Blocking Temp: Room temperature

Primary Anitbody

Dilution RatioDilution Concentration: 0.002, Incubation Dilution Buffer: TBS 0.1% Tween20 5% NFDM, Incubation Time: 1 hr, Incubation Temp: RT

Secondary Antibody

Secondary DescriptionSecondary Ab: Goat anti-Rabbit HRP, Secondary Ab Dilution Ratio: 1/4000

Details

Detection NotesDetection Method: Super Signal West Dura, Exposure Time: 1 minute, Specific Bands: 19 and 17kDa doublet
 
reviewed by:
Anonymous
WB Human 02/18/2009
View

Summary

ApplicationWestern Blot
Sample TestedHuman cancer cells, Sample Amount: 80ug
SpeciesHuman
LotSS

Blocking

Blocking DetailsBlocking Buffer: 5% Milk in PBST, Blocking Time: 30 minutes, Blocking Temp: Room temperature

Primary Anitbody

Dilution RatioPrimary Ab Incubation Time: overnight, Primary Ab Incubation Temp: 4 degrees Celsius

Details

Detection NotesDetection Method: Licor, Exposure Time: 2 minutes, Specific Bands: 17 and 19 kDa

Product General Protocols

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LC3A Antibody (NB100-2331). (Showing 1 - 3 of 3 FAQs).

  1. May we ask if it is possible to perform IF to stain LC3-I and LC3-II separately with two different fluorescent colors?
    • Yes, it is possible to perform IF stain for LC3-I and LC3-II separately with two different fluorescent colors! You will have to use two different primary antibodies and in order to avoid any potential background/cross reactivity issues, I would suggest that you employ conjugated primary antibodies for the testing. 1. Our LC3I antibody (NBP1-78964) has been designed to specifically detect the cytosolic form of the LC3 protein which is actually LC3 I (Note: LC3-II binds to the autophagic membranes). 2. There is not even a single antibody to our knowledge that would exclusively detect the LC3 II form, and you would have to detect LC3II/ autophagic membranes form with an antibody which detects LC3 I/LC3II together. Therefore you may opt second antibody from one of the followings: LC3 Antibody (NB100-2220), LC3 Antibody (NB100-2331), LC3 Antibody (NBP1-19167). All of these mentioned catalog #s come with different options for their conjugated forms and you may select appropriate conjugated forms for performing the IF staining using our explained criteria.
  2. I am interested in detecting the LC3 protein in the sea anemone Aiptasia. I have used your LC3 antibody (NB100-2331) and got a band in my Western blot at around 15 kD, which seems reasonable. However I would like to know how likely it is that your antibody binds to the LC3 protein of Aiptasia? Unfortunately I could not find the protein sequence against which the LC3 antibody was raised to and am hoping you could help me. The protein sequence for the Aiptasia LC3 is: MGDNNVLSYKPFKQRKSFVSRRDEVAGIRAKFPSKVPVIVERYHKERDLPLLDKTKFLVPQELTMSQFVTIIRNRMSLSS TQAFYLIVNNKSLASMSMTMAELYREEKDEDGFLYMVYASQEMFGCNS
    • In comparing the sequences of the human LC3 and Aiptasia proteins, and it seems as though there is very low homology. There is only 62% sequence similarity, and we generally don't recommend antibodies for novel species unless they have at least 85%. There is a chance that it will work, but we cannot guarantee it.
  3. Do you have any data or reason to believe the your LC3 antibody (NB100-2331) has a higher affinity to LC3-II than to LC3-I?
    • No, we do not have any data or reason to believe that NB100-2331 has a higher affinity to LC3-II than to LC3-I. This antibody was raised using a synthetic peptide made to an internal portion of the human LC3 protein sequence (between residues 25-121) as an immunogen and is expected to detect both LC3-I as well as LC3-II, and their signal will depend upon their respective amounts being present in your samples at the time of detection.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Alexa Fluor 350 NB100-2331AF350
Alexa Fluor 405 NB100-2331AF405
Alexa Fluor 488 NB100-2331AF488
Alexa Fluor 532 NB100-2331AF532
Alexa Fluor 594 NB100-2331AF594
Alexa Fluor 647 NB100-2331AF647
Alexa Fluor 700 NB100-2331AF700
Alexa Fluor 750 NB100-2331AF750
Biotin NB100-2331B
DyLight 350 NB100-2331UV
DyLight 405 NB100-2331V
DyLight 488 NB100-2331G
DyLight 550 NB100-2331R
DyLight 594 NB100-2331DL594
DyLight 650 NB100-2331C
DyLight 680 NB100-2331FR
DyLight 755 NB100-2331IR
FITC NB100-2331F
HRP NB100-2331H
Janelia Fluor 549 NB100-2331JF549
Janelia Fluor 646 NB100-2331JF646

Additional LC3A Products

Bioinformatics Tool for LC3A Antibody (NB100-2331)

Discover related pathways, diseases and genes to LC3A Antibody (NB100-2331). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LC3A Antibody (NB100-2331)

Discover more about diseases related to LC3A Antibody (NB100-2331).
 

Pathways for LC3A Antibody (NB100-2331)

View related products by pathway.

PTMs for LC3A Antibody (NB100-2331)

Learn more about PTMs related to LC3A Antibody (NB100-2331).
 

Research Areas for LC3A Antibody (NB100-2331)

Find related products by research area.

Blogs on LC3A.


  Read full blog post.


  Read full blog post.

Nuclear LC3: Why is it there and what is it doing?
By Christina Towers, PhD. Cells use the complex process of autophagy to degrade and recycle cytoplasmic material.  There are over 20 proteins that have been implicated in this process and appropriately named core...  Read full blog post.

Why LC3B Antibodies Make Ideal Autophagosomes Membrane Markers
The human form of microtubule-associated protein light chain 3 (LC3) is expressed as 3 splice variants; LC3A, LC3B and LC3C (He et al., 2003). LC3B is a subunit of the MAP1A and MAP1B microtubule-binding pr...  Read full blog post.

Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4.4
5
9
4
9
3
2
2
0
1
0

Anonymous
06/09/2020
Application: WB
Species: Human

Anonymous
01/29/2019
Application: WB
Species: Mouse

Anonymous
11/25/2017
Application: WB
Species: Mouse and Human

Bioinformatics

Gene Symbol MAP1LC3A