LC3A Antibody

Images

 
Western Blot: LC3A Antibody [NB100-2331] - WB analysis of heart tissue lysates from mice which were subjected or not to 48 hours of starvation. The signal was developed using ECL method and this LC3 antibody was found ...read more
Western Blot: LC3A Antibody [NB100-2331] - Detection of HRP conjugated autophagic LC3 in mouse ES cell lysate. The atg5-/- lane (ES cells, cultured to form embryonic bodies, that are deficient in conversion of LC3-1 to ...read more
Western Blot: LC3A Antibody [NB100-2331] - Analysis in human lysates.
Immunocytochemistry/ Immunofluorescence: LC3A Antibody [NB100-2331] - Analysis in HeLa cells using anti-LC3 antibody (red). Nuclei were counterstained with DAPI (blue).
Immunohistochemistry-Paraffin: LC3A Antibody [NB100-2331] - Staining in mouse meniscus and cartilage. Image from verified customer review.
Western Blot: LC3A Antibody [NB100-2331] - Analysis in human brain lyaste.
Immunocytochemistry/ Immunofluorescence: LC3A Antibody [NB100-2331] - Tested in HeLa cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
Immunocytochemistry/ Immunofluorescence: LC3A Antibody [NB100-2331] - Analysis in PFA fixed NIH/3T3 cells using anti-LC3A antibody. Image from verified customer review.
Immunohistochemistry: LC3A Antibody [NB100-2331] - Staining of human brain, cerebral cortex, cell processes in gray matter.
Immunohistochemistry-Paraffin: LC3A Antibody [NB100-2331] - Analysis in mouse renal tissue. Image courtesy of an anonymous customer review.
Simple Western: LC3A Antibody [NB100-2331] - Simple Western lane view shows a specific band for LC3 in 0.5 mg/ml of Neuro2A lysate. This experiment was performed under reducing conditions using the 12-230 kDa ...read more

Product Details

Summary
Reactivity Hu, Mu, Rt, Ca, Fi, Pl, Ze, Bv, XpSpecies Glossary
Applications WB, Simple Western, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, SB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
1.0 mg/ml
   

Biological Strategies

 

Genetic Strategies

   

LC3A Antibody Summary

Immunogen
A synthetic peptide made to an internal portion of the human LC3 protein sequence (between residues 25-121). [UniProt# Q9H492].
Localization
LC3-I is cytoplasmic. LC3-II binds to the autophagic membranes.
Marker
Autophagosome Marker
Specificity
This antibody detects both LC3A and LC3B.
Predicted Species
Bovine (100%), Xenopus (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAP1LC3A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 2 ug/ml
  • Simple Western 1:50
  • ELISA
  • Flow Cytometry
  • Immunoblotting
  • Immunocytochemistry/Immunofluorescence 1:100-1:300
  • Immunohistochemistry 1:200-1:400
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin 1:200-1:400
  • Immunoprecipitation 20 ug / 500 ug of lysate
  • Southern Blot
Application Notes
This LC3 antibody is useful for Western blot, Immunocytochemistry (PMID 21545732), Immunoprecipitation and Immunohistochemistry in paraffin embedded sections. By Western blot bands are seen at ~19 kDa, representing LC3-I, and ~17 kDa, representing LC3-II. In ICC, cytoplasmic staining was observed in HeLa cells. Use in FLOW cytometry reported in scientific literature ( PMID 24419333). Use in ELISA reported in scientific literature (PMID 20930550). Use in southern blot reported in scientific literature (PMID 21262964).Use in immunoblotting reported in scientific literature (PMID 28253371). In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
Positive Control
LC3B Lysate (NBL1-12844)
Brain Lysate (NB820-59657)
Brain Lysate (NB820-59177)
Neuro2a Lysate (NBP2-19017)
Neuro2a Lysate (NBP2-49688)
HeLa Lysate (NBP2-49689)
Reviewed Applications
Read 18 Reviews rated 4.3
using
NB100-2331 in the following applications:

Publications
Read Publications using
NB100-2331 in the following applications:

  • 2 publications
  • 1 publication
  • IB
    1 publication
  • 27 publications
  • IHC
    7 publications
  • 5 publications
  • 2 publications
  • IP
    3 publications
  • WB
    116 publications
  • 1 publication

Reactivity Notes

Human, mouse, rat and Zebrafish. Fish reactivity reported in scientific literature (PMID: 25522711). Predicted to react with Xenopus and bovine based on 100% sequence homology. Canine reactivity reported in scientific literature (PMID: 26179070). Plant reactivity reported in scientific literature (PMID: 27861739).

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS
Preservative
0.02% Sodium Azide
Concentration
1.0 mg/ml
Purity
Immunogen affinity purified

Alternate Names for LC3A Antibody

  • Apg8
  • APG8a
  • Apg8p3
  • ATG8E
  • Autophagy-related protein LC3 A
  • Autophagy-related ubiquitin-like modifier LC3 A
  • LC3
  • LC3A
  • lc3-i, ii
  • MAP1A/1B light chain 3 A
  • MAP1ALC3
  • MAP1ALC3MAP1A/MAP1B LC3 A
  • MAP1BLC3MAP1A/MAP1B light chain 3 A
  • MAP1LC3A
  • microtubule-associated protein 1 light chain 3 alphaMAP1 light chain 3-like protein 1
  • microtubule-associated proteins 1A/1B light chain 3
  • microtubule-associated proteins 1A/1B light chain 3A
  • MLP3A

Background

LC3 (microtubule-associated protein light chain 3), the most studied autophagy biomarker, was originally identified as a subunit of microtubule-associated proteins 1A and 1B (MAP1LC3) and was later found to contain similarity to yeast protein Apg8/Aut7/Cvt5. Distributed ubiquitously in eukaryotes, LC3 is expressed as 3 splice variants/isoforms (LC3A, LC3B and LC3C) which undergo post-translational processing, wherein, the unprocessed form of LC3 is proteolytically cleaved by Atg4 protease to form LC3-I with carboxyterminal exposed glycine. During autophagy, this exposed glycine of LC3-I is conjugated by Atg7 (an E1-like activity), Atg3 (an E2-like conjugating activity) and by Atg12-Atg5-Atg16L multimers (E3-like ligase activity) to phosphatidylethanolamine (PE) moiety for generating LC3-II. The lipophilic character of PE group facilitates LC3-II insertion into autophagosomes membranes, and as a result LC3-II is degraded when autophagosomes fuse with lysosomes to form autolysosomes for lysus of intra-autophagosomal components by lysosomal hydrolases. Conversion of LC3I to LC3II when correlated with autophagosome numbers is considered as the best marker of autophagy because LC3-II is the only well-characterized protein which specifically localize to autophagic structures throughout autophagy (from phagophore to lysosomal degradation). LC3 is a great tool in research as autophagy is implicated in numerous physiological/pathological processes including responses to exercise/aging, cancer, metabolic and neurodegenerative disorders, and cardiovascular/pulmonary diseases.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00008878-M01
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
NB500-249
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
H00002965-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP1-85091
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37399
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NBP2-02627
Species: Hu, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-19151
Species: Hu, Ma
Applications: WB, IHC-P, IP
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NB110-53818
Species: Hu, Mu, Rt, Po, Bv, Pm, Xp, Ze
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NBP1-88883
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-55202
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB6608
Species: Hu, Mu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICC, ICFlow
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NB120-19294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-2331
Species: Hu, Mu, Rt, Ca, Fi, Pl, Ze, Bv, Xp
Applications: WB, Simple Western, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, SB

Publications for LC3A Antibody (NB100-2331)(197)

We have publications tested in 7 confirmed species: Human, Mouse, Rat, Canine, Fish, Plant, Zebrafish.

We have publications tested in 10 applications: ELISA, FLOW, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB, WB,IP.


Filter By Application
ELISA
(2)
FLOW
(1)
IB
(1)
ICC/IF
(27)
IHC
(7)
IHC-Fr
(5)
IHC-P
(2)
IP
(3)
WB
(116)
WB,IP
(1)
All Applications
Filter By Species
Human
(67)
Mouse
(50)
Rat
(8)
Canine
(1)
Fish
(2)
Plant
(1)
Zebrafish
(3)
All Species
Showing Publications 1 - 10 of 197. Show All 197 Publications.
Publications using NB100-2331 Applications Species
Desseille C, Deforges S, Biondi O et al. Specific Physical Exercise Improves Energetic Metabolism in the Skeletal Muscle of Amyotrophic-Lateral-Sclerosis Mice. Frontiers in Molecular Neuroscience. 2017 Oct 20 [PMID: 29104532] (WB, Mouse) WB Mouse
Theofilas P, Ehrenberg AJ, Nguy A et al. Probing the correlation of neuronal loss, neurofibrillary tangles, and cell death markers across the Alzheimer's disease Braak stages: a quantitative study in humans. Neurobiol. Aging. 2017 Sep 20 [PMID: 29031088] (ICC/IF, IHC, Human) ICC/IF, IHC Human
Kaverina N, Borovjagin AV, Kadagidze Z et al. Astrocytes promote progression of breast cancer metastases to the brain via a KISS1-mediated autophagy. Autophagy. 2017 Oct 05 [PMID: 28981380] (ICC/IF) ICC/IF
Solanas G, Peixoto FO, Perdiguero E et al. Aged Stem Cells Reprogram Their Daily Rhythmic Functions to Adapt to Stress Cell 2017 Aug 10 [PMID: 28802040] (Mouse) Mouse
Benitez BA, Sands MS. Primary fibroblasts from CSPalpha mutation carriers recapitulate hallmarks of the adult onset neuronal ceroid lipofuscinosis Sci Rep 2017 Jul 24 [PMID: 28740222] (WB, Human) WB Human
Nazim UM, Moon JH, Lee YJ et al. PPARy activation by troglitazone enhances human lung cancer cells to TRAIL-induced apoptosis via autophagy flux. Oncotarget Apr 18 2017 [PMID: 28460464] (WB, Human) WB Human
Bae SY, Byun S, Bae SH et al. TPT1 (tumor protein, translationally-controlled 1) negatively regulates autophagy through the BECN1 interactome and an MTORC1-mediated pathway. Autophagy. Feb 15 2017 [PMID: 28409693] (WB, Mouse) WB Mouse
Yue F, Li W, Zou J et al. Spermidine prolongs lifespan and prevents liver fibrosis and hepatocellular carcinoma by activating MAP1S-mediated autophagy. Cancer Res. Apr 6 2017 [PMID: 28386016] (WB, Human) WB Human
Lopez A, Lee SE, Wojta K et al. A152T tau allele causes neurodegeneration that can be ameliorated in a zebrafish model by autophagy induction. Brain. Feb 9 2017 [PMID: 28334843] (WB, Fish) WB Fish
Mattoscio D, Casadio C, Miccolo C et al. Autophagy regulates UBC9 levels during viral-mediated tumorigenesis. PLoS Pathog. Mar 1 2017 [PMID: 28253371] (IB, Human) IB Human
Show All 197 Publications.

Reviews for LC3A Antibody (NB100-2331) (18) 4.318

Average Rating: 4.3
(Based on 18 reviews)
We have 18 reviews tested in 4 species: Human, Mouse, Mouse and Human, Other.
We have 18 reviews tested in 4 application: WB, IF, IHC-P, IHC.

Reviews using NB100-2331:
Filter by Applications
WB
(15)
IF
(1)
IHC-P
(1)
IHC
(1)
All Applications
Filter by Species
Human
(8)
Mouse
(7)
Mouse and Human
(1)
Other
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot LC3A NB100-2331
Enlarge
reviewed by:
Anonymous
WB Mouse and Human 11/25/2017
View

Summary

ApplicationWestern Blot
Sample Testedmouse hepatocytes and HepG2 cells
SpeciesMouse and Human
LotAC-1
Western Blot LC3A NB100-2331
Enlarge
reviewed by:
Anonymous
WB Mouse 08/07/2017
View

Summary

ApplicationWestern Blot
Sample TestedMouse macrophage cell line RAW 264.7
SpeciesMouse
LotH6-NB100-2331
 
reviewed by:
jennifer guadagno
WB Mouse 10/06/2015
View

Summary

ApplicationWestern Blot
Sample TestedMouse Neuro2A, Mouse Cortical Neurons whole cell lysate
SpeciesMouse
LotR-4

Blocking

Blocking Details10% non-fat dry milk in TBS-T (0.05% Tween) for 1hr at room temperature

Primary Anitbody

Dilution Ratio1:1000

Secondary Antibody

Secondary DescriptionGoat-anti rabbit HRP
Secondary Concentration1:5000 in 3% milk in TBS-T (0.05%)

Details

Detection NotesClarity ECL, Biorad Chemidoc imager, exposed for 1 min, Neg control= untreated cells, Pos Control= rapamycin

Comments

CommentsThis antibody works very well. Very strong clear signal.
Western Blot LC3A NB100-2331
Enlarge
reviewed by:
Anonymous
WB Human 01/12/2015
View

Summary

ApplicationWestern Blot
Sample Testedhuman glioblastoma
SpeciesHuman

Blocking

Blocking DetailsLi-Cor blockin bufffer

Primary Anitbody

Dilution Ratio2 ug/ml, overnight, room temperature, TBST buffer

Secondary Antibody

Secondary Descriptionanti-IgG secondary antibodies, Conjugation: IRDye® 800CW
Secondary Manufacturer Cat#Li-Cor
Secondary Concentrationper vendor recomendations

Details

Detection NotesOdyssey Li-Cor

Comments

CommentsPlease site our paper:Tamoxifen improves cytopathic effect of oncolytic adenovirus in primary glioblastoma cells mediated through autophagy." just accepted for Oncotarget.
 
reviewed by:
Anonymous
WB Mouse 12/12/2014
View

Summary

ApplicationWestern Blot
Sample TestedSee PMID 22892563
SpeciesMouse

Blocking

Blocking DetailsSee PMID 22892563

Details

Detection NotesSee PMID 22892563

Comments

CommentsPublished in PMID: 22892563
Immunofluorescence LC3A NB100-2331
Enlarge
reviewed by:
Anonymous
IF Mouse 11/25/2014
View

Summary

ApplicationImmunofluorescence
Sample TestedNIH3T3, HeLa, HEK293T, N2a neuroblastoma, Q7 striatal, Sy5Y neuroblastoma
SpeciesMouse

Blocking

Blocking Details1% BSA + 1%milk

Primary Anitbody

Dilution Ratio1:100 for IF

Secondary Antibody

Secondary DescriptionCy5 conjuagated anti-rabbit
Secondary Concentration1:500

Details

Detection NotesImages taken by Zeiss Axiovert microscope
Fixation DetailsPFA Fixed, 0.1% Tween20 permeabilized, PBS, 1hr primary incubation at RT
Wash DescriptionPBS 3x washes, 2 mins each
Immunohistochemistry-Paraffin LC3A NB100-2331
Enlarge
reviewed by:
Merissa Olmer
IHC-P 10/04/2014
View

Summary

ApplicationImmunohistochemistry-Paraffin
LotS-1
CommentsThese tissue samples were fixed with zinc buffered formalin.
Western Blot LC3A NB100-2331
Enlarge
reviewed by:
Ilya Ulasov
WB Human 06/30/2014
View

Summary

ApplicationWestern Blot
Sample Testedhuman tumor cells
SpeciesHuman
Lotq-1

Blocking

Blocking Details#917-40000, LI-COR

Primary Anitbody

Dilution Ratioin agreement with vendor recommendation

Secondary Antibody

Secondary Descriptiongoat-anti-rabbit
Secondary Manufacturer Cat#Li-COR

Details

Detection NotesOdyssey Imaging System (Model #1866, Li-COR Biosciences
 
reviewed by:
Anonymous
WB Human 06/20/2014
View

Summary

ApplicationWestern Blot
SpeciesHuman
Pub Med ID24735980
FileView PDF
Western Blot LC3A NB100-2331
Enlarge
reviewed by:
Kumsal Tekirdag
WB Human 04/02/2014
View

Summary

ApplicationWestern Blot
SpeciesHuman
LotS-2
Special ApplicationsGives slighter LC3-I band compared to LC3II. Stronger binding to LC3II. High level of background at first usage in BSA solution.
Pub Med ID24358205
FileView PDF
Immunohistochemistry LC3A NB100-2331
Enlarge
reviewed by:
Nirmala Parajuli
IHC Mouse 08/13/2012
View

Summary

ApplicationImmunohistochemistry
Sample TestedRenal tissue (paraffin block)
SpeciesMouse
LotN
CommentsAntibody is good for immunohistochemistry. But, since this is polyclonal, each lot has to be tested for concentration of primary antibody to get desired results.

Blocking

Blocking DetailsProtein block, Dako, 20 min RT

Primary Anitbody

Dilution Ratio1:10,000, 4dC, ON, 0.1%BSA plus0.05% skim milk

Secondary Antibody

Secondary DescriptionGoat anti-rabbit-HRP
Secondary Manufacturer Cat#DAKO, #K4011
Secondary ConcentrationDAKO kit

Details

Detection NotesDAB, 5 min
Fixation Details10% NBF, 10mM Sodium Citrate buffer pH6.0
Wash DescriptionTBS-T, 5 min X 4

Comments

CommentsAntibody is good for immunohistochemistry. But, since this is polyclonal, each lot has to be tested for concentration of primary antibody to get desired results.
Western Blot LC3A NB100-2331
Enlarge
reviewed by:
Anonymous
WB Human 12/28/2011
View

Summary

ApplicationWestern Blot
Sample TestedHuman
SpeciesHuman
CommentsGood antibody!

Blocking

Blocking DetailsBlocking Buffer: 10% non-fat milk

Primary Anitbody

Dilution RatioPrimary Ab Dilution Ratio: 1:1000, Primary Ab Incubation Time: overnight

Secondary Antibody

Secondary DescriptionSecondary Ab: rabbit

Details

Detection NotesDetection Method: HRP

Comments

CommentsGood antibody!
 
reviewed by:
Anonymous
WB Human 11/21/2011
View

Summary

ApplicationWestern Blot
Sample TestedHuman
SpeciesHuman

Blocking

Blocking DetailsBlocking Buffer: 5% Milk

Primary Anitbody

Dilution RatioPrimary Ab Dilution Ratio: 1:1000, Primary Ab Incubation Time: overnight, Primary Ab Incubation Temp: 4 degrees Celsius

Secondary Antibody

Secondary DescriptionSecondary Ab Dilution Ratio: 1:5000

Details

Detection NotesDetection Method: ECL-HRP
 
reviewed by:
Anonymous
WB Human 11/21/2011
View

Summary

ApplicationWestern Blot
Sample TestedHuman
SpeciesHuman

Blocking

Blocking DetailsBlocking Buffer: 2% Skim Milk

Primary Anitbody

Dilution RatioPrimary Ab Dilution Ratio: 1:1000, Primary Ab Incubation Time: overnight, Primary Ab Incubation Temp: 4 degrees Celsius

Secondary Antibody

Secondary DescriptionSecondary Ab: Goat anti-rabbit HRP

Details

Detection NotesDetection Method: ECL
 
reviewed by:
Anonymous
WB Mouse 10/24/2011
View

Summary

ApplicationWestern Blot
Sample TestedMouse
SpeciesMouse
CommentsThe antibody worked well!

Blocking

Blocking DetailsBlocking Buffer: 5% Milk

Primary Anitbody

Dilution RatioPrimary Ab Dilution Ratio: 1:5000, Primary Ab Incubation Time: 16 hours

Secondary Antibody

Secondary DescriptionSecondary Ab: anti-mouse HRP antibody

Details

Detection NotesDetection Method: ECL

Comments

CommentsThe antibody worked well!
 
reviewed by:
Seung-Hyun Ro
WB Mouse 07/08/2010
View

Summary

ApplicationWestern Blot
Sample Tested3T3-L1 adipocyte, Sample Amount: 30ug
SpeciesMouse
LotH2
CommentsI used in for 3T3-L1 mouse adipocyte and it is working great.

Blocking

Blocking DetailsBlocking Buffer: 5% Milk in PBST, Blocking Time: 1 hour, Blocking Temp: Room temperature

Primary Anitbody

Dilution RatioDilution Ratio: 1:1000, Incubation Dilution Buffer: PBST, Incubation Time: 2 hours, Incubation Temp: room temperature

Secondary Antibody

Secondary DescriptionSecondary Ab: Rabbit, Secondary Ab Dilution Ratio: 1:3000
Secondary Manufacturer Cat#Santa Cruz sc-2077

Details

Detection NotesDetection Method: ECL - perkin elmer, Exposure Time: 1 minute, Positive Control: Actin, Specific Bands: 15, 18 kDa

Comments

CommentsI used in for 3T3-L1 mouse adipocyte and it is working great.
Western Blot LC3A NB100-2331
Enlarge
reviewed by:
Anonymous
WB Other 11/05/2009
View

Summary

ApplicationWestern Blot
Sample Testedlysed cell lines, Sample Amount: 20 ug
SpeciesOther
LotJ

Blocking

Blocking DetailsBlocking Buffer: TBS 0.1% Tween20 5% NFDM, Blocking Time: 1 hour, Blocking Temp: Room temperature

Primary Anitbody

Dilution RatioDilution Concentration: 0.002, Incubation Dilution Buffer: TBS 0.1% Tween20 5% NFDM, Incubation Time: 1 hr, Incubation Temp: RT

Secondary Antibody

Secondary DescriptionSecondary Ab: Goat anti-Rabbit HRP, Secondary Ab Dilution Ratio: 1/4000

Details

Detection NotesDetection Method: Super Signal West Dura, Exposure Time: 1 minute, Specific Bands: 19 and 17kDa doublet
 
reviewed by:
Anonymous
WB Human 02/18/2009
View

Summary

ApplicationWestern Blot
Sample TestedHuman cancer cells, Sample Amount: 80ug
SpeciesHuman
LotSS

Blocking

Blocking DetailsBlocking Buffer: 5% Milk in PBST, Blocking Time: 30 minutes, Blocking Temp: Room temperature

Primary Anitbody

Dilution RatioPrimary Ab Incubation Time: overnight, Primary Ab Incubation Temp: 4 degrees Celsius

Details

Detection NotesDetection Method: Licor, Exposure Time: 2 minutes, Specific Bands: 17 and 19 kDa

Product General Protocols

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LC3A Antibody (NB100-2331). (Showing 1 - 3 of 3 FAQs).

  1. May we ask if it is possible to perform IF to stain LC3-I and LC3-II separately with two different fluorescent colors?
    • Yes, it is possible to perform IF stain for LC3-I and LC3-II separately with two different fluorescent colors! You will have to use two different primary antibodies and in order to avoid any potential background/cross reactivity issues, I would suggest that you employ conjugated primary antibodies for the testing. 1. Our LC3I antibody (NBP1-78964) has been designed to specifically detect the cytosolic form of the LC3 protein which is actually LC3 I (Note: LC3-II binds to the autophagic membranes). 2. There is not even a single antibody to our knowledge that would exclusively detect the LC3 II form, and you would have to detect LC3II/ autophagic membranes form with an antibody which detects LC3 I/LC3II together. Therefore you may opt second antibody from one of the followings: LC3 Antibody (NB100-2220), LC3 Antibody (NB100-2331), LC3 Antibody (NBP1-19167). All of these mentioned catalog #s come with different options for their conjugated forms and you may select appropriate conjugated forms for performing the IF staining using our explained criteria.
  2. I am interested in detecting the LC3 protein in the sea anemone Aiptasia. I have used your LC3 antibody (NB100-2331) and got a band in my Western blot at around 15 kD, which seems reasonable. However I would like to know how likely it is that your antibody binds to the LC3 protein of Aiptasia? Unfortunately I could not find the protein sequence against which the LC3 antibody was raised to and am hoping you could help me. The protein sequence for the Aiptasia LC3 is: MGDNNVLSYKPFKQRKSFVSRRDEVAGIRAKFPSKVPVIVERYHKERDLPLLDKTKFLVPQELTMSQFVTIIRNRMSLSS TQAFYLIVNNKSLASMSMTMAELYREEKDEDGFLYMVYASQEMFGCNS
    • In comparing the sequences of the human LC3 and Aiptasia proteins, and it seems as though there is very low homology. There is only 62% sequence similarity, and we generally don't recommend antibodies for novel species unless they have at least 85%. There is a chance that it will work, but we cannot guarantee it.
  3. Do you have any data or reason to believe the your LC3 antibody (NB100-2331) has a higher affinity to LC3-II than to LC3-I?
    • No, we do not have any data or reason to believe that NB100-2331 has a higher affinity to LC3-II than to LC3-I. This antibody was raised using a synthetic peptide made to an internal portion of the human LC3 protein sequence (between residues 25-121) as an immunogen and is expected to detect both LC3-I as well as LC3-II, and their signal will depend upon their respective amounts being present in your samples at the time of detection.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Alexa Fluor 405 Labeled NB100-2331AF405
Alexa Fluor 488 Labeled NB100-2331AF488
Alexa Fluor 647 Labeled NB100-2331AF647
Alexa Fluor 700 Labeled NB100-2331AF700
Biotin Labeled NB100-2331B
DyLight 405 Labeled NB100-2331V
DyLight 488 Labeled NB100-2331G
DyLight 550 Labeled NB100-2331R
DyLight 650 Labeled NB100-2331C
FITC Labeled NB100-2331F
HRP Labeled NB100-2331H

Additional LC3A Products

Bioinformatics Tool for LC3A Antibody (NB100-2331)

Discover related pathways, diseases and genes to LC3A Antibody (NB100-2331). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LC3A Antibody (NB100-2331)

Discover more about diseases related to LC3A Antibody (NB100-2331).
 

Pathways for LC3A Antibody (NB100-2331)

View related products by pathway.

PTMs for LC3A Antibody (NB100-2331)

Learn more about PTMs related to LC3A Antibody (NB100-2331).
 

Research Areas for LC3A Antibody (NB100-2331)

Find related products by research area.

Blogs on LC3A

There are no specific blogs for LC3A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4.3
5
8
4
8
3
2
2
0
1
0

Anonymous
11/25/2017
Application: WB
Species: Mouse and Human

Anonymous
08/07/2017
Application: WB
Species: Mouse

 
jennifer guadagno
10/06/2015
Application: WB
Species: Mouse

Bioinformatics

Gene Symbol MAP1LC3A
Entrez