LC3A Antibody


Western Blot: LC3A Antibody [NB100-2331] - High autophagosome concentration is consumed during early immortalized human mesenchymal stem cell differentiation. Immortalized human mesenchymal stem cells were more
Immunocytochemistry/ Immunofluorescence: LC3A Antibody [NB100-2331] - Analysis in PFA fixed NIH/3T3 cells using anti-LC3A antibody. Image from verified customer review.
Immunohistochemistry: LC3A Antibody [NB100-2331] - Staining in mouse meniscus and cartilage. Image from verified customer review.
Western Blot: LC3A Antibody [NB100-2331] - Autophagy mobilized during differentiation of immortalized human mesenchymal stem cells (ihMSCs). Cultured ihMSCs were stimulated to undergo osteogenesis to form osteoblasts more
Western Blot: LC3A Antibody [NB100-2331] - This LC3A antibody Image shows Analysis in human cell lysates.
Western Blot: LC3A Antibody [NB100-2331] - This LC3A antibody Image shows analysis of heart tissue lysates from mice which were subjected or not to 48 hours of starvation. The signal was developed using ECL method and more
Western Blot: LC3A Antibody [NB100-2331] - Detection of HRP conjugated autophagic LC3 in mouse ES cell lysate. The atg5-/- lane (ES cells, cultured to form embryonic bodies, that are deficient in conversion of LC3-1 to more
Immunocytochemistry/ Immunofluorescence: LC3A Antibody [NB100-2331] - This LC3A antibody Image shows an analysis in HeLa cells using anti-LC3 antibody (red). Nuclei were counterstained with DAPI (blue).
Immunocytochemistry/ Immunofluorescence: LC3A Antibody [NB100-2331] - Left panel shows untreated HeLa cells. Right panel shows HeLa cells that were treated with 50 uM CQ overnight. Cells were fixed for 10 minutes using more
Immunohistochemistry: LC3A Antibody [NB100-2331] - Rapamycin increases autophagy in brains of PDAPP mice. Representative epifluorescent (c200x) image of hippocampal CA1 in control- and rapamycin-fed transgenic PDAPP more
Immunohistochemistry: LC3A Antibody [NB100-2331] - Analysis in mouse renal tissue. Image from verifed customer review.
Simple Western: LC3A Antibody [NB100-2331] - Image shows a specific band for LC3 in 0.5 mg/mL of Neuro2A lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Product Details

Reactivity Hu, Mu, Rt, Am, Ca, Fi, Pl, Ze, BvSpecies Glossary
Applications WB, Simple Western, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, SB, IHC-WhMt
1.0 mg/ml

LC3A Antibody Summary

This LC3A Antibody was prepared from a synthetic peptide made to an internal portion of the human LC3 protein sequence (between residues 25-121). [Uniprot: Q9H492].
LC3-I is cytoplasmic. LC3-II binds to the autophagic membranes.
Autophagosome Marker
This LC3A Antibody detects both LC3A and LC3B.
Predicted Species
Bovine (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
  • Simple Western 1:50
  • Chromatin Immunoprecipitation
  • Flow Cytometry
  • Immunoblotting
  • Immunocytochemistry/Immunofluorescence 1:100-1:300
  • Immunohistochemistry 1:200-1:400
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin 1:200-1:400
  • Immunoprecipitation 20 ug / 500 ug of lysate
  • Southern Blot
  • Immunohistochemistry Whole-Mount
Application Notes
Western blot bands are seen at ~19 kDa, representing LC3-I, and ~17 kDa, representing LC3-II. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. In ICC, cytoplasmic staining was observed in HeLa cells. Use in immunocytochemistry (PMID: 21545732). and Immunohistochemistry-Paraffin (PMID: 26571030). reported in scientific literature. Use in Flow cytometry reported in scientific literature ( PMID: 24419333).. Use in ELISA reported in scientific literature (PMID: 20930550).. Use in Immunohistochemistry-Whole mount reported in scientific literature (PMID: 31783118).. Use in Southern blot reported in scientific literature (PMID: 21262964).. Use in immunoblotting reported in scientific literature (PMID: 28253371).. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Use in Chromatin Immunoprecipitation reported in scientific literature (PMID:33035707).
Mouse Brain Whole Tissue Lysate (Adult Whole Normal)
Human Brain Whole Tissue Lysate (Adult Whole Normal)
Neuro2a Whole Cell Lysate
Neuro2a Chloroquine Treated / Untreated Cell Lysate
HeLa Chloroquine Treated / Untreated Cell Lysate
Reviewed Applications
Read 22 Reviews rated 4.3
NB100-2331 in the following applications:

Read Publications using
NB100-2331 in the following applications:

Reactivity Notes

Use in Rat reported in scientific literature (PMID:33678798). Use in Amphibian reported in scientific literature (PMID:29777142).

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
0.02% Sodium Azide
1.0 mg/ml
Immunogen affinity purified

Alternate Names for LC3A Antibody

  • Apg8
  • APG8a
  • Apg8p3
  • ATG8E
  • Autophagy-related protein LC3 A
  • Autophagy-related ubiquitin-like modifier LC3 A
  • LC3
  • LC3A
  • MAP1 light chain 3-like protein 1
  • MAP1A/1B light chain 3 A
  • MAP1A/MAP1B light chain 3 A
  • MAP1ALC3
  • MAP1BLC3
  • MAP1LC3A
  • Microtubule-associated protein 1 light chain 3 alpha
  • microtubule-associated proteins 1A/1B light chain 3
  • microtubule-associated proteins 1A/1B light chain 3A
  • MLP3A


Human Microtubule-associated Protein 1A/1B Light Chain 3A (MAP1LC3A), also called LC3A for short, is a 121 amino acid (aa) protein with a theoretic molecular weight of ~14 kDa. LC3A belongs to the LC3 subfamily of Autophagy-related 8 (Atg8) proteins, which also includes LC3B and LC3C (1). The process of autophagy is the bulk degradation of proteins and organelles. Whether these three proteins have distinct roles in autophagy remains unclear, but they do have unique subcellular expression (2). Specifically, LC3A shows perinuclear and nuclear localization (2). The Atg8 family members share a similar structure of two amino-terminal alpha-helices and a ubiquitin-like core but are unique in aa sequence (1). LC3 utilizes a ubiquitin-like conjugation system to covalently bind to phosphatidylethanolamine (PE), also called lipidation, which is mediated by a series of steps (1, 3). Briefly, unprocessed, cytosolic LC3 (pro-LC3) is cleaved by the cysteine protease Atg4 to expose a c-terminal glycine (Gly) residue (LC3-I); the Gly is activated by E1-like enzyme Atg7, transferred to E2-like enzyme Atg3, and an E3-like complex facilitates the conjugation of LC3 with PE (LC3-II), incorporating it into the phagophore membrane during autophagosome formation (1, 3). The recruitment of LC3 to the phagophore is thought to mediate membrane elongation and closure (1, 3). Additionally, LC3 plays a role in recruiting cargo (protein aggregates, pathogens, and organelles) to autophagosomes and delivery for lysosomal degradation (1).

The process of autophagy is associated with a variety of diseases including neurodegenerative diseases, neuromuscular, tumorigenesis, and viral and bacterial infections (4). LC3 is a useful marker of autophagy in both healthy and diseased cells (4). Interestingly, LC3A has two variants (v1 and v2) which differ in N-terminal sequence due to the varying transcriptional start sites (5). One particular study found that LC3Av1, but not v2 or LC3B, was silenced in various cancer cell lines due to aberrant DNA methylation and re-expression of LC3Av1 in LC3Av1-silenced cells inhibited tumor growth, where overall findings suggest a possible tumor-suppressive role (5).

Alternative names for LC3A include Apg8, APG8a, ATG8E, Autophagy-related protein LC3 A, Autophagy-related ubiquitin-like modifier LC3 A, MAP1A/1B light chain 3 A, microtubule-associated proteins 1A/1B light chain 3, and MLP3A.


1. Shpilka, T., Weidberg, H., Pietrokovski, S., & Elazar, Z. (2011). Atg8: an autophagy-related ubiquitin-like protein family. Genome biology.

2. Koukourakis, M. I., Kalamida, D., Giatromanolaki, A., Zois, C. E., Sivridis, E., Pouliliou, S., Mitrakas, A., Gatter, K. C., & Harris, A. L. (2015). Autophagosome Proteins LC3A, LC3B and LC3C Have Distinct Subcellular Distribution Kinetics and Expression in Cancer Cell Lines. PloS one.

3. Weidberg, H., Shvets, E., & Elazar, Z. (2011). Biogenesis and cargo selectivity of autophagosomes. Annual review of biochemistry.

4. Tanida, I., Ueno, T., & Kominami, E. (2004). LC3 conjugation system in mammalian autophagy. The international journal of biochemistry & cell biology.

5. Schaaf, M. B., Keulers, T. G., Vooijs, M. A., & Rouschop, K. M. (2016). LC3/GABARAP family proteins: autophagy-(un)related functions. FASEB journal : official publication of the Federation of American Societies for Experimental Biology.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Bv, Ha, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA, KD
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Bv, Ma
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Al, Bv, Dr, Fi, Gp, Pm, Xp, Ze
Applications: WB, Simple Western, EM, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, PLA, RIA, KD, KO
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Ch, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, HEStain, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, IHC-FrFl, KD, KO
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICC, ICFlow
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC

Publications for LC3A Antibody (NB100-2331)(264)

We have publications tested in 8 confirmed species: Human, Mouse, Rat, Amphibian, Canine, Fish, Plant, Zebrafish.

We have publications tested in 12 applications: ChIP, ELISA, FLOW, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-WhMt, IP, WB, WB,IP.

Filter By Application
All Applications
Filter By Species
All Species
Showing Publications 1 - 10 of 264. Show All 264 Publications.
Publications using NB100-2331 Applications Species
Kang HK, Sarsenova M, Kim DH et al. Establishing a 3D In Vitro Hepatic Model Mimicking Physiologically Relevant to In Vivo State Cells May 20 2021 [PMID: 34065411] (WB, Human) WB Human
Sayed WM, Elzainy A Impact of platelet-rich plasma versus selenium in ameliorating induced toxicity in rat testis: histological, immunohistochemical, and molecular study Cell and tissue research Apr 1 2021 [PMID: 33791879] (WB, Rat) WB Rat
Kim J, Kim SH, Kang H et al. TFEB-GDF15 axis protects against obesity and insulin resistance as a lysosomal stress response Nature metabolism Mar 1 2021 [PMID: 33758420]
Huang Y, Liu HT, Yuan Y et al. Exercise Preconditioning Increases Beclin1 and Induces Autophagy to Promote Early Myocardial Protection via Intermittent Myocardial Ischemia-Hypoxia International heart journal Mar 30 2021 [PMID: 33678798] (WB, Rat) WB Rat
Manganelli V, Capozzi A, Recalchi S et al. The Role of Cardiolipin as a Scaffold Mitochondrial Phospholipid in Autophagosome Formation: In Vitro Evidence Biomolecules Feb 5 2021 [PMID: 33562550] (WB, Human) WB Human
Ordog K, Horvath O, Eros K, et al. Mitochondrial protective effects of PARP-inhibition in hypertension-induced myocardial remodeling and in stressed cardiomyocytes Life sciences Jan 6 2021 [PMID: 33421523] (WB, Rat) WB Rat
Pargianas M, Kosmas I, Papageorgiou K et al. Follicle inhibition at the primordial stage without increasing apoptosis, with a combination of everolimus, verapamil Mol Biol Rep Oct 20 2020 [PMID: 33079326]
Zhuang L, Ly R, Rosl F, Niebler M p53 Is Regulated in a Biphasic Manner in Hypoxic Human Papillomavirus Type 16 (HPV16)-Positive Cervical Cancer Cells International journal of molecular sciences Dec 15 2020 [PMID: 33333786] (WB, Human) WB Human
Moon Y, Kim I, Chang S et al. Sigma-1 receptor regulates mitophagy in dopaminergic neurons and contributes to dopaminergic protection Biochim Biophys Acta Gene Regul Mech Oct 26 2020 [PMID: 33035707] (ChIP, WB, Human, Mouse) ChIP, WB Human, Mouse
Show All 264 Publications.

Reviews for LC3A Antibody (NB100-2331) (22) 4.322

Average Rating: 4.3
(Based on 22 reviews)
We have 22 reviews tested in 5 species: Human, Mouse, Rat, Human and Mouse, Other.

Reviews using NB100-2331:
Filter by Applications
All Applications
Filter by Species
Human and Mouse
All Species
Images Ratings Applications Species Date Details
Immunocytochemistry LC3A NB100-2331
reviewed by:
Verified Customer
ICC Human 05/21/2021


Sample TestedHuman microglia,Human microglia cell lysate
Western Blot LC3A NB100-2331
reviewed by:
Verified Customer
WB Rat 05/21/2021


ApplicationWestern Blot
Sample TestedMICROGLIA
Western Blot LC3A NB100-2331
reviewed by:
Verified Customer
WB Human 06/09/2020


ApplicationWestern Blot
Sample TestedTHP-1 cell lysate


CommentsThe antibody works great to detect the LC3 from THP-1 cell lysates
Western Blot LC3A NB100-2331
reviewed by:
Verified Customer
WB Mouse 01/29/2019


ApplicationWestern Blot
Sample Testedlysed cell lines, Sample Amount: 20 ug
Western Blot LC3A NB100-2331
reviewed by:
Verified Customer
WB Human and Mouse 11/25/2017


ApplicationWestern Blot
Sample Testedmouse hepatocytes and HepG2 cells
SpeciesHuman and Mouse
Western Blot LC3A NB100-2331
reviewed by:
Verified Customer
WB Mouse 08/07/2017


ApplicationWestern Blot
Sample TestedMouse macrophage cell line RAW 264.7
reviewed by:
jennifer guadagno
WB Mouse 10/06/2015


ApplicationWestern Blot
Sample TestedMouse Neuro2A, Mouse Cortical Neurons whole cell lysate


Blocking Details10% non-fat dry milk in TBS-T (0.05% Tween) for 1hr at room temperature

Primary Anitbody

Dilution Ratio1:1000

Secondary Antibody

Secondary DescriptionGoat-anti rabbit HRP
Secondary Concentration1:5000 in 3% milk in TBS-T (0.05%)


Detection NotesClarity ECL, Biorad Chemidoc imager, exposed for 1 min, Neg control= untreated cells, Pos Control= rapamycin


CommentsThis antibody works very well. Very strong clear signal.
Western Blot LC3A NB100-2331
reviewed by:
Verified Customer
WB Human 01/12/2015


ApplicationWestern Blot
Sample Testedhuman glioblastoma


Blocking DetailsLi-Cor blockin bufffer

Primary Anitbody

Dilution Ratio2 ug/ml, overnight, room temperature, TBST buffer

Secondary Antibody

Secondary Descriptionanti-IgG secondary antibodies, Conjugation: IRDye® 800CW
Secondary Manufacturer Cat#Li-Cor
Secondary Concentrationper vendor recomendations


Detection NotesOdyssey Li-Cor


CommentsPlease site our paper:Tamoxifen improves cytopathic effect of oncolytic adenovirus in primary glioblastoma cells mediated through autophagy." just accepted for Oncotarget.
reviewed by:
Verified Customer
WB Mouse 12/12/2014


ApplicationWestern Blot
Sample TestedSee PMID 22892563


Blocking DetailsSee PMID 22892563


Detection NotesSee PMID 22892563


CommentsPublished in PMID: 22892563
Immunofluorescence LC3A NB100-2331
reviewed by:
Verified Customer
IF Mouse 11/25/2014


Sample TestedNIH3T3, HeLa, HEK293T, N2a neuroblastoma, Q7 striatal, Sy5Y neuroblastoma


Blocking Details1% BSA + 1%milk

Primary Anitbody

Dilution Ratio1:100 for IF

Secondary Antibody

Secondary DescriptionCy5 conjuagated anti-rabbit
Secondary Concentration1:500


Detection NotesImages taken by Zeiss Axiovert microscope
Fixation DetailsPFA Fixed, 0.1% Tween20 permeabilized, PBS, 1hr primary incubation at RT
Wash DescriptionPBS 3x washes, 2 mins each
Immunohistochemistry-Paraffin LC3A NB100-2331
reviewed by:
Merissa Olmer
IHC-P 10/04/2014


CommentsThese tissue samples were fixed with zinc buffered formalin.
Western Blot LC3A NB100-2331
reviewed by:
Ilya Ulasov
WB Human 06/30/2014


ApplicationWestern Blot
Sample Testedhuman tumor cells


Blocking Details#917-40000, LI-COR

Primary Anitbody

Dilution Ratioin agreement with vendor recommendation

Secondary Antibody

Secondary Descriptiongoat-anti-rabbit
Secondary Manufacturer Cat#Li-COR


Detection NotesOdyssey Imaging System (Model #1866, Li-COR Biosciences
reviewed by:
Verified Customer
WB Human 06/20/2014


ApplicationWestern Blot
Pub Med ID24735980
FileView PDF
Western Blot LC3A NB100-2331
reviewed by:
Kumsal Tekirdag
WB Human 04/02/2014


ApplicationWestern Blot
Special ApplicationsGives slighter LC3-I band compared to LC3II. Stronger binding to LC3II. High level of background at first usage in BSA solution.
Pub Med ID24358205
FileView PDF
Immunohistochemistry LC3A NB100-2331
reviewed by:
Nirmala Parajuli
IHC Mouse 08/13/2012


Sample TestedRenal tissue (paraffin block)
CommentsAntibody is good for immunohistochemistry. But, since this is polyclonal, each lot has to be tested for concentration of primary antibody to get desired results.


Blocking DetailsProtein block, Dako, 20 min RT

Primary Anitbody

Dilution Ratio1:10,000, 4dC, ON, 0.1%BSA plus0.05% skim milk

Secondary Antibody

Secondary DescriptionGoat anti-rabbit-HRP
Secondary Manufacturer Cat#DAKO, #K4011
Secondary ConcentrationDAKO kit


Detection NotesDAB, 5 min
Fixation Details10% NBF, 10mM Sodium Citrate buffer pH6.0
Wash DescriptionTBS-T, 5 min X 4


CommentsAntibody is good for immunohistochemistry. But, since this is polyclonal, each lot has to be tested for concentration of primary antibody to get desired results.
Western Blot LC3A NB100-2331
reviewed by:
Verified Customer
WB Human 12/28/2011


ApplicationWestern Blot
Sample TestedHuman
CommentsGood antibody!


Blocking DetailsBlocking Buffer: 10% non-fat milk

Primary Anitbody

Dilution RatioPrimary Ab Dilution Ratio: 1:1000, Primary Ab Incubation Time: overnight

Secondary Antibody

Secondary DescriptionSecondary Ab: rabbit


Detection NotesDetection Method: HRP


CommentsGood antibody!
reviewed by:
Verified Customer
WB Human 11/21/2011


ApplicationWestern Blot
Sample TestedHuman


Blocking DetailsBlocking Buffer: 5% Milk

Primary Anitbody

Dilution RatioPrimary Ab Dilution Ratio: 1:1000, Primary Ab Incubation Time: overnight, Primary Ab Incubation Temp: 4 degrees Celsius

Secondary Antibody

Secondary DescriptionSecondary Ab Dilution Ratio: 1:5000


Detection NotesDetection Method: ECL-HRP
reviewed by:
Verified Customer
WB Human 11/21/2011


ApplicationWestern Blot
Sample TestedHuman


Blocking DetailsBlocking Buffer: 2% Skim Milk

Primary Anitbody

Dilution RatioPrimary Ab Dilution Ratio: 1:1000, Primary Ab Incubation Time: overnight, Primary Ab Incubation Temp: 4 degrees Celsius

Secondary Antibody

Secondary DescriptionSecondary Ab: Goat anti-rabbit HRP


Detection NotesDetection Method: ECL
reviewed by:
Verified Customer
WB Mouse 10/24/2011


ApplicationWestern Blot
Sample TestedMouse
CommentsThe antibody worked well!


Blocking DetailsBlocking Buffer: 5% Milk

Primary Anitbody

Dilution RatioPrimary Ab Dilution Ratio: 1:5000, Primary Ab Incubation Time: 16 hours

Secondary Antibody

Secondary DescriptionSecondary Ab: anti-mouse HRP antibody


Detection NotesDetection Method: ECL


CommentsThe antibody worked well!
reviewed by:
Seung-Hyun Ro
WB Mouse 07/08/2010


ApplicationWestern Blot
Sample Tested3T3-L1 adipocyte, Sample Amount: 30ug
CommentsI used in for 3T3-L1 mouse adipocyte and it is working great.


Blocking DetailsBlocking Buffer: 5% Milk in PBST, Blocking Time: 1 hour, Blocking Temp: Room temperature

Primary Anitbody

Dilution RatioDilution Ratio: 1:1000, Incubation Dilution Buffer: PBST, Incubation Time: 2 hours, Incubation Temp: room temperature

Secondary Antibody

Secondary DescriptionSecondary Ab: Rabbit, Secondary Ab Dilution Ratio: 1:3000
Secondary Manufacturer Cat#Santa Cruz sc-2077


Detection NotesDetection Method: ECL - perkin elmer, Exposure Time: 1 minute, Positive Control: Actin, Specific Bands: 15, 18 kDa


CommentsI used in for 3T3-L1 mouse adipocyte and it is working great.
reviewed by:
Verified Customer
WB Other 11/05/2009


ApplicationWestern Blot
Sample Testedlysed cell lines, Sample Amount: 20 ug


Blocking DetailsBlocking Buffer: TBS 0.1% Tween20 5% NFDM, Blocking Time: 1 hour, Blocking Temp: Room temperature

Primary Anitbody

Dilution RatioDilution Concentration: 0.002, Incubation Dilution Buffer: TBS 0.1% Tween20 5% NFDM, Incubation Time: 1 hr, Incubation Temp: RT

Secondary Antibody

Secondary DescriptionSecondary Ab: Goat anti-Rabbit HRP, Secondary Ab Dilution Ratio: 1/4000


Detection NotesDetection Method: Super Signal West Dura, Exposure Time: 1 minute, Specific Bands: 19 and 17kDa doublet
reviewed by:
Verified Customer
WB Human 02/18/2009


ApplicationWestern Blot
Sample TestedHuman cancer cells, Sample Amount: 80ug


Blocking DetailsBlocking Buffer: 5% Milk in PBST, Blocking Time: 30 minutes, Blocking Temp: Room temperature

Primary Anitbody

Dilution RatioPrimary Ab Incubation Time: overnight, Primary Ab Incubation Temp: 4 degrees Celsius


Detection NotesDetection Method: Licor, Exposure Time: 2 minutes, Specific Bands: 17 and 19 kDa

Product General Protocols

Video Protocols

WB Video Protocol
ChIP Video Protocol
ChIP Webinar
ICC/IF Video Protocol

FAQs for LC3A Antibody (NB100-2331). (Showing 1 - 3 of 3 FAQs).

  1. May we ask if it is possible to perform IF to stain LC3-I and LC3-II separately with two different fluorescent colors?
    • Yes, it is possible to perform IF stain for LC3-I and LC3-II separately with two different fluorescent colors! You will have to use two different primary antibodies and in order to avoid any potential background/cross reactivity issues, I would suggest that you employ conjugated primary antibodies for the testing. 1. Our LC3I antibody (NBP1-78964) has been designed to specifically detect the cytosolic form of the LC3 protein which is actually LC3 I (Note: LC3-II binds to the autophagic membranes). 2. There is not even a single antibody to our knowledge that would exclusively detect the LC3 II form, and you would have to detect LC3II/ autophagic membranes form with an antibody which detects LC3 I/LC3II together. Therefore you may opt second antibody from one of the followings: LC3 Antibody (NB100-2220), LC3 Antibody (NB100-2331), LC3 Antibody (NBP1-19167). All of these mentioned catalog #s come with different options for their conjugated forms and you may select appropriate conjugated forms for performing the IF staining using our explained criteria.
  2. I am interested in detecting the LC3 protein in the sea anemone Aiptasia. I have used your LC3 antibody (NB100-2331) and got a band in my Western blot at around 15 kD, which seems reasonable. However I would like to know how likely it is that your antibody binds to the LC3 protein of Aiptasia? Unfortunately I could not find the protein sequence against which the LC3 antibody was raised to and am hoping you could help me. The protein sequence for the Aiptasia LC3 is: MGDNNVLSYKPFKQRKSFVSRRDEVAGIRAKFPSKVPVIVERYHKERDLPLLDKTKFLVPQELTMSQFVTIIRNRMSLSS TQAFYLIVNNKSLASMSMTMAELYREEKDEDGFLYMVYASQEMFGCNS
    • In comparing the sequences of the human LC3 and Aiptasia proteins, and it seems as though there is very low homology. There is only 62% sequence similarity, and we generally don't recommend antibodies for novel species unless they have at least 85%. There is a chance that it will work, but we cannot guarantee it.
  3. Do you have any data or reason to believe the your LC3 antibody (NB100-2331) has a higher affinity to LC3-II than to LC3-I?
    • No, we do not have any data or reason to believe that NB100-2331 has a higher affinity to LC3-II than to LC3-I. This antibody was raised using a synthetic peptide made to an internal portion of the human LC3 protein sequence (between residues 25-121) as an immunogen and is expected to detect both LC3-I as well as LC3-II, and their signal will depend upon their respective amounts being present in your samples at the time of detection.

Control Lysate(s)

Secondary Antibodies


Isotype Controls

Other Available Formats

Alexa Fluor 350 NB100-2331AF350
Alexa Fluor 405 NB100-2331AF405
Alexa Fluor 488 NB100-2331AF488
Alexa Fluor 532 NB100-2331AF532
Alexa Fluor 594 NB100-2331AF594
Alexa Fluor 647 NB100-2331AF647
Alexa Fluor 700 NB100-2331AF700
Alexa Fluor 750 NB100-2331AF750
Biotin NB100-2331B
DyLight 350 NB100-2331UV
DyLight 405 NB100-2331V
DyLight 488 NB100-2331G
DyLight 550 NB100-2331R
DyLight 594 NB100-2331DL594
DyLight 650 NB100-2331C
DyLight 680 NB100-2331FR
DyLight 755 NB100-2331IR
FITC NB100-2331F
HRP NB100-2331H
Janelia Fluor 549 NB100-2331JF549
Janelia Fluor 646 NB100-2331JF646

Additional LC3A Products

Bioinformatics Tool for LC3A Antibody (NB100-2331)

Discover related pathways, diseases and genes to LC3A Antibody (NB100-2331). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LC3A Antibody (NB100-2331)

Discover more about diseases related to LC3A Antibody (NB100-2331).

Pathways for LC3A Antibody (NB100-2331)

View related products by pathway.

PTMs for LC3A Antibody (NB100-2331)

Learn more about PTMs related to LC3A Antibody (NB100-2331).

Research Areas for LC3A Antibody (NB100-2331)

Find related products by research area.

Blogs on LC3A.

The LC3 A, B, C’s and 1, 2, 3’s
By Christina Towers, PhD Autophagy is a catabolic process used to breakdown and recycle damaged proteins and organelles. It is a multistep process that, in its simplest form, consists of 4 steps: initiation, phago...  Read full blog post.

Losing memory: Toxicity from mutant APP and amyloid beta explain the hippocampal neuronal damage in Alzheimer's disease
 By Jamshed Arslan Pharm.D.  Alzheimer's disease (AD) is an irreversible brain disorder that destroys memory and thinking skills. The telltale signs of AD brains are extracellular deposits of amy...  Read full blog post.

Nuclear LC3: Why is it there and what is it doing?
By Christina Towers, PhD. Cells use the complex process of autophagy to degrade and recycle cytoplasmic material.  There are over 20 proteins that have been implicated in this process and appropriately named core...  Read full blog post.

Why LC3B Antibodies Make Ideal Autophagosomes Membrane Markers
The human form of microtubule-associated protein light chain 3 (LC3) is expressed as 3 splice variants; LC3A, LC3B and LC3C (He et al., 2003). LC3B is a subunit of the MAP1A and MAP1B microtubule-binding pr...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Recent Reviews


Verified Customer
Application: ICC
Species: Human

Verified Customer
Application: WB
Species: Rat

Verified Customer
Application: WB
Species: Human


Gene Symbol MAP1LC3A