GABARAPL1 Antibody

Western Blot: GABARAPL1 Antibody [NBP1-55202] - Hela Whole Cell lysates, Antibody Dilution: 1.0 ug/ml.

Immunohistochemistry-Paraffin: GABARAPL1 Antibody [NBP1-55202] - Human Brain lysate tissue at an Antibody concentration of 5.0 ug/ml using anti-GABARAPL1 Antibody (NBP1-55202).

Western Blot: GABARAPL1 Antibody [NBP1-55202] - Transfected 293T tissue lysate at a concentration of 1ug/ml.

Immunohistochemistry-Paraffin: GABARAPL1 Antibody [NBP1-55202] - Human Brain Tissue, antibody concentration 5ug/ml. Cells with positive label: Neural cells (indicated with arrows) 400X mgnification.

Immunohistochemistry-Paraffin: GABARAPL1 Antibody [NBP1-55202] - Human spleen.

• Reactivity: Hu
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

GABARAPL1 Antibody Summary

• Immunogen: Synthetic peptides corresponding to GABARAPL1(GABA(A) receptor-associated protein like 1) The peptide sequence was selected from the N terminal of GABARAPL1 (NP_113600). Peptide sequence MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYL. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GABARAPL1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 5 ug/ml
  • Immunohistochemistry-Paraffin 5 ug/ml
  • Western Blot 1.0 ug/ml
• Theoretical MW: 14 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for GABARAPL1 Antibody

• APG8L
• APG8-LIKE
• ATG8
• ATG8B
• ATG8L
• Early estrogen-regulated protein
• GABA(A) receptor-associated protein like 1
• GABARAPL1
• gamma-aminobutyric acid receptor-associated protein-like 1
• GEC1
• GEC-1
• GEC1GABA(A) receptor-associated protein-like 1
• Glandular epithelial cell protein 1

Background

GABARAPL1 increases cell-surface expression of kappa-type opioid receptor through facilitating anterograde intracellular trafficking of the receptor.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GABARAPL1
• Entrez:
  • 23710(Human)
• Uniprot:
  • Q9H0R8()