GABARAPL1 Antibody


Western Blot: GABARAPL1 Antibody [NBP1-55202] - Hela Whole Cell lysates, Antibody Dilution: 1.0 ug/ml.
Immunohistochemistry-Paraffin: GABARAPL1 Antibody [NBP1-55202] - Human Brain lysate tissue at an Antibody concentration of 5.0 ug/ml using anti-GABARAPL1 Antibody (ARP55398_P050).
Western Blot: GABARAPL1 Antibody [NBP1-55202] - Transfected 293T tissue lysate at a concentration of 1ug/ml.
Immunohistochemistry-Paraffin: GABARAPL1 Antibody [NBP1-55202] - Human Brain Tissue, antibody concentration 5ug/ml. Cells with positive label: Neural cells (indicated with arrows) 400X mgnification.
Immunohistochemistry-Paraffin: GABARAPL1 Antibody [NBP1-55202] - Human spleen.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

GABARAPL1 Antibody Summary

Synthetic peptides corresponding to GABARAPL1(GABA(A) receptor-associated protein like 1) The peptide sequence was selected from the N terminal of GABARAPL1 (NP_113600). Peptide sequence MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYL.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1 ug/ml
  • Immunohistochemistry 5 ug/ml
  • Immunohistochemistry-Paraffin 5 ug/ml
Theoretical MW
14 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for GABARAPL1 Antibody

  • APG8L
  • ATG8
  • ATG8B
  • ATG8L
  • Early estrogen-regulated protein
  • GABA(A) receptor-associated protein like 1
  • gamma-aminobutyric acid receptor-associated protein-like 1
  • GEC1
  • GEC-1
  • GEC1GABA(A) receptor-associated protein-like 1
  • Glandular epithelial cell protein 1


GABARAPL1 increases cell-surface expression of kappa-type opioid receptor through facilitating anterograde intracellular trafficking of the receptor.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Ca, Fi, Pl, Ze
Applications: WB, Simple Western, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, SB
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICC, ICFlow
Species: Hu, Mu, Rt, Po, Bv, Pm, Xp, Ze
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, PLA
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
Species: Hu, Mu, Rt
Applications: WB, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Pm
Applications: WB, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
Species: Hu, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Ba, Bv, Ca, SyHa, Pm, Ze
Applications: WB, Simple Western, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, ChIP, KO
Species: Hu, Ma
Applications: WB, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for GABARAPL1 Antibody (NBP1-55202) (0)

There are no publications for GABARAPL1 Antibody (NBP1-55202).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GABARAPL1 Antibody (NBP1-55202) (0)

There are no reviews for GABARAPL1 Antibody (NBP1-55202). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GABARAPL1 Antibody (NBP1-55202) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional GABARAPL1 Products

Bioinformatics Tool for GABARAPL1 Antibody (NBP1-55202)

Discover related pathways, diseases and genes to GABARAPL1 Antibody (NBP1-55202). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GABARAPL1 Antibody (NBP1-55202)

Discover more about diseases related to GABARAPL1 Antibody (NBP1-55202).

Pathways for GABARAPL1 Antibody (NBP1-55202)

View related products by pathway.

PTMs for GABARAPL1 Antibody (NBP1-55202)

Learn more about PTMs related to GABARAPL1 Antibody (NBP1-55202).

Research Areas for GABARAPL1 Antibody (NBP1-55202)

Find related products by research area.

Blogs on GABARAPL1

There are no specific blogs for GABARAPL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our GABARAPL1 Antibody and receive a gift card or discount.


Gene Symbol GABARAPL1