Insulin Antibody - BSA Free

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: Insulin Antibody [NBP1-87485] - Staining in human pancreas and liver tissues using anti-INS antibody. Corresponding INS RNA-seq data are presented for the ...read more
Immunohistochemistry-Paraffin: Insulin Antibody [NBP1-87485] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: Insulin Antibody [NBP1-87485] - Staining of human pancreas shows high expression.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications Flow, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Validated by:
       

Orthogonal Strategies

 

Order Details

View Available Formulations
Catalog# & Formulation Size Price

Insulin Antibody - BSA Free Summary

Description
Novus Biologicals Rabbit Insulin Antibody - BSA Free (NBP1-87485) is a polyclonal antibody validated for use in IHC and Flow. Anti-Insulin Antibody: Cited in 4 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYC
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
INS
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Flow Cytometry Reported in scientific literature (PMID: 28824164)
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Insulin Protein (NBP1-87485PEP)
Publications
Read Publications using
NBP1-87485 in the following applications:

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Insulin Antibody - BSA Free

  • IDDM2
  • ILPR
  • INS
  • Insulin
  • IRDN
  • MODY10
  • proinsulin

Background

After removal of the precursor signal peptide, proinsulin is post-translationally cleaved into two chains (peptide A and peptide B) that are covalently linked via two disulfide bonds. Binding of this mature form of insulin to the insulin receptor (INSR) stimulates glucose uptake. A variety of mutant alleles with changes in the coding region have been identified. There is a read-through gene, INS-IGF2, which overlaps with this gene at the 5' region and with the IGF2 gene at the 3' region. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
291-G1
Species: Hu
Applications: BA
DLP00
Species: Hu
Applications: ELISA
AF1067
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
NBP2-12793
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
DRP300
Species: Hu
Applications: ELISA
AF1067
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
NBP2-37447
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P
NBP1-49533
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC,  IHC-P, KD, WB
NBP1-90927
Species: Hu
Applications: IHC,  IHC-P, WB
DY1707
Species: Hu
Applications: ELISA
236-EG
Species: Hu
Applications: BA
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
M6000B
Species: Mu
Applications: ELISA
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
AF1445
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P

Publications for Insulin Antibody (NBP1-87485)(4)

Reviews for Insulin Antibody (NBP1-87485) (0)

There are no reviews for Insulin Antibody (NBP1-87485). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Insulin Antibody (NBP1-87485). (Showing 1 - 1 of 1 FAQs).

  1. Will you please recommend me antibodies to insulin, the most suitable for immunohistochemistry in the pancreas of guinea pigs? Desirable to be conjugated with some pigment and there was no need for secondary antibodies.
    • I have carried out a search and the best antibody I recommend is NB600-1488. This is a primary unconjugated antibody however and you will need a secondary. If you click on the product link and then click on related products, a list of all recommended secondary antibodies will appear.

Secondary Antibodies

 

Isotype Controls

Additional Insulin Products

Research Areas for Insulin Antibody (NBP1-87485)

Find related products by research area.

Blogs on Insulin. Showing 1-10 of 13 blog posts - Show all blog posts.

Immune Cell Metabolic Flux Influences Type I Diabetes
By Hunter MartinezWhat is Immunometabolism?It is well established that abnormal metabolic environments can be a risk factor for disease development. One characteristic example is the role of dyslipidemia (high lev...  Read full blog post.

COVID-19 and metabolic dysregulation: SARS-CoV-2 injures human exocrine and endocrine pancreas
Jamshed Arslan, Pharm D, PhD Humans rely on the pancreas for digesting food and generating energy from it. SARS-CoV-2-mediated damage to the exocrine pancreas is evident from the pancreatitis, pancreatic enlargeme...  Read full blog post.

Insulin signaling in adipocytes: Carbohydrate-signaling transcription factor ChREBP is the link between lipolytic enzyme Hormone-Sensitive Lipase and lipogenic enzyme ELOVL6
By Jamshed Arslan, Pharm. D., PhD. Insulin resistance in adipocytes is a major feature of metabolic syndrome   . Disrupted adipose tissue metabolism can lead to accumulation of lipid intermediates in insul...  Read full blog post.

Inhibiting incretin GIP hormone activity in mouse and monkey models to combat obesity
By Jamshed Arslan, Pharm. D., PhD. We live in a world where 39% of adults are overweight. Our meals trigger the secretion of various gut-derived metabolic hormones called incretins. Fats and carbohydrates in our die...  Read full blog post.

Insulin signaling in brain’s subfornical organ is crucial for regulating cardiometabolic profile
By Jamshed Arslan, Pharm. D., PhD. The hypothalamus is an insulin receptor-rich brain region. Insulin receptor signaling in the CNS can regulate blood pressure, for example, by increasing sympathetic outflow to th...  Read full blog post.

Eat responsibly: Epigenetic downregulation of Ankrd26 gene by long-term high-fat intake promotes obesity and inflammation
By Jamshed Arslan Pharm.D. White adipose tissue (WAT) represents the primary site to store energy in humans. WAT’s endocrine regulation of energy balance is controlled by nutritional status, exercise, and hormones l...  Read full blog post.

Application Focus: New Methods for iPSC Differentiation, Inducing a Mammary Fate
Discovery of the Key to PluripotencyInduced pluripotent stem cells (iPSCs) may be generated from a wide range of fully differentiated cells, and under optimal conditions may be prompted to differentiate into virtu...  Read full blog post.

The effects of curcumin on IKB Alpha and the NFkB signaling pathway
The IKK complex, or inhibitor of NFkB kinase, is composed of IKK alpha and IKK beta.  These kinases are at the core of the NFkB signaling cascade.  The NFkB family is made up of transcription factors that are kept inactive in the cytoplasm through...  Read full blog post.

AMPK Alpha 1 and lipid metabolism of adipocytes
AMP-activated protein kinase (AMPK) is best known as a sensor of oxidative stress.  AMPK is activated by increased intracellular AMP levels, which are a result of alterations in cellular metabolism from causes such as hypoxia, changes in ATP, sene...  Read full blog post.

ChREBP, a glucose sensitive transcription factor with role in glucose-lipids homeostasis and cancer
ChREBP (carbohydrate response element-binding protein) is a glucose responsive basic helix-loop-helix/leucine zipper (bHLH/LZ) transcription factor that binds MLX and then carbohydrate response element /ChoRE for the induction of genes involved in ...  Read full blog post.

Showing 1-10 of 13 blog posts - Show all blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Insulin Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol INS
Entrez