![Western Blot: gamma-glutamyl hydrolase Antibody [NBP1-90927] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY418375)](http://images.novusbio.com/fullsize2/gamma-glutamyl-hydrolase-Antibody-Western-Blot-NBP1-90927-img0005.jpg "Western Blot: gamma-glutamyl hydrolase Antibody [NBP1-90927] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY418375)")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FDDGDYFPVWGTCLGFEELSLLISGECLLTATDTVDVAMPLNFTGGQLHSRMFQNFPTELLLSLAVEPLTANFHKWSLSVKNFTMNEKLKK |
| Specificity | Specificity of human gamma-glutamyl hydrolase antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | GGH |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Positive Control |
|
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Diseases for gamma-glutamyl hydrolase Antibody (NBP1-90927)Discover more about diseases related to gamma-glutamyl hydrolase Antibody (NBP1-90927).
| Pathways for gamma-glutamyl hydrolase Antibody (NBP1-90927)View related products by pathway.
|
PTMs for gamma-glutamyl hydrolase Antibody (NBP1-90927)Learn more about PTMs related to gamma-glutamyl hydrolase Antibody (NBP1-90927).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | GGH |
![Immunohistochemistry-Paraffin: gamma-glutamyl hydrolase Antibody [NBP1-90927] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize2/gamma-glutamyl-hydrolase-Antibody-Immunohistochemistry-Paraffin-NBP1-90927-img0002.jpg "Immunohistochemistry-Paraffin: gamma-glutamyl hydrolase Antibody [NBP1-90927] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.")
![Western Blot: Prolactin Antibody (6B1) [NBP2-02142] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Prolactin (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Prolactin.](http://images.novusbio.com/fullsize/Prolactin Antibody (6B1)-Western Blot-NBP2-02142-img0003.jpg)
![Immunocytochemistry/Immunofluorescence: Prolactin Antibody (6B1) [NBP2-02142] Staining of COS7 cells transiently transfected by pCMV6-ENTRY Prolactin.](http://images.novusbio.com/fullsize/Prolactin Antibody (6B1)-Immunocytochemistry-Immunofluorescence-NBP2-02142-img0008.jpg)
![Immunohistochemistry-Paraffin: Prolactin Antibody (6B1) [NBP2-02142] - Staining of paraffin-embedded Human Ovary tissue using anti-Prolactin mouse monoclonal antibody.](http://images.novusbio.com/fullsize/Prolactin Antibody (6B1)-Immunohistochemistry-Paraffin-NBP2-02142-img0007.jpg)
![Western Blot: GHRH Antibody [NBP2-29915] - Western blot analysis in MDA-MB231 cell line lysates (35ug/lane).This demonstrates the GHRH antibody detected the GHRH protein (arrow).](http://images.novusbio.com/fullsize2/GHRH-Antibody-Western-Blot-NBP2-29915-img0001.jpg)
![Immunocytochemistry/Immunofluorescence: GHRH Antibody [NBP2-29915] - Confocal immunofluorescent analysis of GHRH Antibody (N-term) with 293 cell followed by Alexa Fluor 488-conjugated goat anti-rabbit lgG (green). DAPI was used to stain the cell nuclear (blue).](http://images.novusbio.com/fullsize2/GHRH-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-29915-img0003.jpg)
![Immunohistochemistry-Paraffin: GHRH Antibody [NBP2-29915] - Formalin-fixed and paraffin-embedded human lung carcinoma tissue reacted with GHRH antibody (N-term) (Cat.#NBP2-29915), which was peroxidase-conjugated to the secondary antibody, followed by DAB staining. This data demonstrates the use of this antibody for immunohistochemistry; clinical relevance has not been evaluated.](http://images.novusbio.com/fullsize2/GHRH-Antibody-Immunohistochemistry-Paraffin-NBP2-29915-img0004.jpg)
![Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Formalin-fixed, paraffin-embedded human pancreas stained with insulin Monoclonal Antibody (E2-E3)](http://images.novusbio.com/fullsize2/Insulin-Antibody-(E2-E3-(same-as-INS04))-Immunohistochemistry-Paraffin-NBP2-34260-img0002.jpg)
![SDS-Page: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260]](http://images.novusbio.com/fullsize2/Insulin Antibody (E2-E3 (same as INS04))-SDS-Page-NBP2-34260-img0003.jpg)
![Western Blot: PBX1 Antibody (4A2) [H00005087-M01] - PBX1 monoclonal antibody (M01), clone 4A2 Analysis of PBX1 expression in Hela S3 NE.](http://images.novusbio.com/fullsize2/PBX1 Antibody (4A2)-Western Blot-H00005087-M01-img0010.jpg)
![Immunocytochemistry/Immunofluorescence: PBX1 Antibody (4A2) [H00005087-M01] - Analysis of monoclonal antibody to PBX1 on HeLa cell. Antibody concentration 10 ug/ml.](http://images.novusbio.com/fullsize2/PBX1-Antibody-(4A2)-Immunocytochemistry-Immunofluorescence-H00005087-M01-img0006.jpg)
![Immunohistochemistry-Paraffin: PBX1 Antibody (4A2) [H00005087-M01] - Analysis of monoclonal antibody to PBX1 on formalin-fixed paraffin-embedded human salivary gland. Antibody concentration 3 ug/ml.](http://images.novusbio.com/fullsize2/PBX1-Antibody-(4A2)-Immunohistochemistry-Paraffin-H00005087-M01-img0008.jpg)
![Western Blot: POMC Antibody [NB100-1533] - Western blot analysis of POMC using NB100-1533 at 0.01ug/ml in NIH 3T3 lysate (35ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.](http://images.novusbio.com/fullsize/POMC Antibody-Western Blot-NB100-1533-img0001.jpg)
![Immunohistochemistry-Paraffin: POMC Antibody [NB100-1533] - Analysis in human Anterior Pituitary Gland shows vesilulate staining in glandular cells.](http://images.novusbio.com/fullsize2/POMC-Antibody-Immunohistochemistry-Paraffin-NB100-1533-img0003.jpg)
![Immunohistochemistry-Paraffin: Thyrotropin Releasing Hormone Antibody [NBP2-34014] - Staining of human prostate shows low expression as expected.](http://images.novusbio.com/fullsize2/Thyrotropin-Releasing-Hormone-Antibody-Immunohistochemistry-Paraffin-NBP2-34014-img0013.jpg)
![Immunohistochemistry-Paraffin: Thyrotropin Releasing Hormone Antibody [NBP2-34014] - Analysis in human cervix, uterine and prostate tissues using Anti-TRH antibody. Corresponding TRH RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/Thyrotropin-Releasing-Hormone-Antibody-Immunohistochemistry-Paraffin-NBP2-34014-img0010.jpg)
![Immunohistochemistry-Paraffin: Thyrotropin Releasing Hormone Antibody [NBP2-34014] - Staining of human cervix, uterine shows high expression.](http://images.novusbio.com/fullsize2/Thyrotropin-Releasing-Hormone-Antibody-Immunohistochemistry-Paraffin-NBP2-34014-img0011.jpg)
![Western Blot: PLOD1 Antibody [NBP2-38770] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG](http://images.novusbio.com/fullsize2/PLOD1-Antibody-Western-Blot-NBP2-38770-img0002.jpg)
![Immunohistochemistry-Paraffin: PLOD1 Antibody [NBP2-38770] - Staining of human placenta shows cytoplasmic positivity in decidual cells.](http://images.novusbio.com/fullsize2/PLOD1-Antibody-Immunohistochemistry-Paraffin-NBP2-38770-img0003.jpg)
![Western Blot: BRD2 Antibody [NBP1-30475] - Detection of Human and Mouse BRD2 by Western Blot. Samples: Whole cell lysate (50 ug) from HeLa, 293T, and mouse NIH3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-BRD2 antibody NBP1-30475 used for WB at 0.04 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.](http://images.novusbio.com/fullsize2/BRD2-Antibody-Western-Blot-NBP1-30475-img0019.jpg)
![Immunocytochemistry/Immunofluorescence: BRD2 Antibody [NBP1-30475] - Affinity purified rabbit anti-BRD2 used at a dilution of 1:100 (2ug/ml). Detection: Red-fluorescent goat anti-rabbit IgG cross-adsorbed Antibody DyLight 594 conjugated.](http://images.novusbio.com/fullsize2/BRD2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-30475-img0013.jpg)
![Immunohistochemistry: BRD2 Antibody [NBP1-30475] - Sample: FFPE section of human ovarian carcinoma. Antibody: Affinity purified rabbit anti-BRD2 used at a dilution of 1:50 (4ug/ml). Detection: DAB staining using Immunohistochemistry Accessory Kit](http://images.novusbio.com/fullsize2/BRD2-Antibody-Immunohistochemistry-NBP1-30475-img0017.jpg)
![Western Blot: Adenine Nucleotide Translocator 2 Antibody [NBP2-56762] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.](http://images.novusbio.com/fullsize2/Adenine Nucleotide Translocator 2 Antibody-Western Blot-NBP2-56762-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: Adenine Nucleotide Translocator 2 Antibody [NBP2-56762] - Staining of human cell line PC-3 shows localization to mitochondria.](http://images.novusbio.com/fullsize2/Adenine-Nucleotide-Translocator-2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-56762-img0001.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - FLOW analysis of Mouse CD4+ T cells that were stimulated with anti-CD3/CD28 beads and insulin (1ug/mL) for 5 days in culture media with additional glucose provided. PE conjugated Glut1 antibody stained cells (NB110-39113PE, Orange) were included as positive control which were compared with Rb IgG PE, NBP2-24983 as Isotype Control (Blue) as well as with fluorescence minus one/FMO control (Red) [Image submitted by Verified Customer - see Review for Protocol Details]. Image using the PE form of this antibody.](http://images.novusbio.com/images2/Rabbit-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0005.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - FLOW analysis of Mouse CD4+ T cells that were stimulated with anti-CD3/CD28 beads and insulin (1ug/mL) for 5 days in culture media with additional glucose provided. PE conjugated Glut1 antibody stained cells (NB110-39113PE, Orange) were included as positive control which were compared with Rb IgG PE, NBP2-24983 as Isotype Control (Blue) as well as with fluorescence minus one/FMO control (Red) [Image submitted by Verified Customer - see Review for Protocol Details]. Image using the PE form of this antibody.")