gamma-glutamyl hydrolase Antibody

Images

 
Western Blot: gamma-glutamyl hydrolase Antibody [NBP1-90927] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate ...read more
Immunohistochemistry-Paraffin: gamma-glutamyl hydrolase Antibody [NBP1-90927] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

gamma-glutamyl hydrolase Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FDDGDYFPVWGTCLGFEELSLLISGECLLTATDTVDVAMPLNFTGGQLHSRMFQNFPTELLLSLAVEPLTANFHKWSLSVKNFTMNEKLKK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GGH
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
gamma-glutamyl hydrolase Protein (NBP1-90927PEP)
Publications
Read Publication using NBP1-90927.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23374458)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for gamma-glutamyl hydrolase Antibody

  • Conjugase
  • EC 3.4.19.9
  • gamma-glutamyl hydrolase (conjugase, folylpolygammaglutamyl hydrolase)
  • gamma-glutamyl hydrolase
  • Gamma-Glu-X carboxypeptidase
  • GH

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-29915
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
H00005087-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-34014
Species: Hu
Applications: IHC, IHC-P
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
AF1360
Species: Mu
Applications: WB, IHC
MAB8200
Species: Hu, Mu
Applications: IHC
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow

Publications for gamma-glutamyl hydrolase Antibody (NBP1-90927)(1)

Reviews for gamma-glutamyl hydrolase Antibody (NBP1-90927) (0)

There are no reviews for gamma-glutamyl hydrolase Antibody (NBP1-90927). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for gamma-glutamyl hydrolase Antibody (NBP1-90927) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional gamma-glutamyl hydrolase Products

Bioinformatics Tool for gamma-glutamyl hydrolase Antibody (NBP1-90927)

Discover related pathways, diseases and genes to gamma-glutamyl hydrolase Antibody (NBP1-90927). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for gamma-glutamyl hydrolase Antibody (NBP1-90927)

Discover more about diseases related to gamma-glutamyl hydrolase Antibody (NBP1-90927).
 

Pathways for gamma-glutamyl hydrolase Antibody (NBP1-90927)

View related products by pathway.

PTMs for gamma-glutamyl hydrolase Antibody (NBP1-90927)

Learn more about PTMs related to gamma-glutamyl hydrolase Antibody (NBP1-90927).

Blogs on gamma-glutamyl hydrolase

There are no specific blogs for gamma-glutamyl hydrolase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our gamma-glutamyl hydrolase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GGH