gamma-glutamyl hydrolase Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: FDDGDYFPVWGTCLGFEELSLLISGECLLTATDTVDVAMPLNFTGGQLHSRMFQNFPTELLLSLAVEPLTANFHKWSLSVKNFTMNEKLKK |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
GGH |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
- Western Blot 0.04-0.4 ug/ml
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Control Peptide |
|
Publications |
|
Reactivity Notes
Reactivity reported in scientific literature (PMID: 23374458)
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for gamma-glutamyl hydrolase Antibody
Background
The gamma-glutamyl hydrolase gene catalyzes the hydrolysis of folylpoly-gamma-glutamates and antifolylpoly-gamma-glutamates by the removal of gamma-linked polyglutamates and glutamate. (provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu, Pm, Mu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IF, IHC, IHC-P, WB
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: IHC
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
Species: Hu
Applications: ELISA
Species: Hu
Applications: WB, IHC, IHC-P
Publications for gamma-glutamyl hydrolase Antibody (NBP1-90927)(1)
Showing Publication 1 -
1 of 1.
Reviews for gamma-glutamyl hydrolase Antibody (NBP1-90927) (0)
There are no reviews for gamma-glutamyl hydrolase Antibody (NBP1-90927).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for gamma-glutamyl hydrolase Antibody (NBP1-90927) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional gamma-glutamyl hydrolase Products
Bioinformatics Tool for gamma-glutamyl hydrolase Antibody (NBP1-90927)
Discover related pathways, diseases and genes to gamma-glutamyl hydrolase Antibody (NBP1-90927). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for gamma-glutamyl hydrolase Antibody (NBP1-90927)
Discover more about diseases related to gamma-glutamyl hydrolase Antibody (NBP1-90927).
| | Pathways for gamma-glutamyl hydrolase Antibody (NBP1-90927)
View related products by pathway.
|
PTMs for gamma-glutamyl hydrolase Antibody (NBP1-90927)
Learn more about PTMs related to gamma-glutamyl hydrolase Antibody (NBP1-90927).
| | Research Areas for gamma-glutamyl hydrolase Antibody (NBP1-90927)
Find related products by research area.
|
Blogs on gamma-glutamyl hydrolase