Home » gamma-glutamyl hydrolase » gamma-glutamyl hydrolase Antibodies » gamma-glutamyl hydrolase Antibody

gamma-glutamyl hydrolase Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: gamma-glutamyl hydrolase Antibody [NBP1-90927] - Analysis in control (vector only transfected HEK293T lysate) and GGH over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Western Blot: gamma-glutamyl hydrolase Antibody [NBP1-90927] - Analysis in control (vector only transfected HEK293T lysate) and GGH over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in ...read more
Immunohistochemistry-Paraffin: gamma-glutamyl hydrolase Antibody [NBP1-90927] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

gamma-glutamyl hydrolase Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FDDGDYFPVWGTCLGFEELSLLISGECLLTATDTVDVAMPLNFTGGQLHSRMFQNFPTELLLSLAVEPLTANFHKWSLSVKNFTMNEKLKK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GGH
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
gamma-glutamyl hydrolase Protein (NBP1-90927PEP)
Publications
Read Publication using NBP1-90927.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23374458)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for gamma-glutamyl hydrolase Antibody

  • Conjugase
  • EC 3.4.19.9
  • gamma-glutamyl hydrolase (conjugase, folylpolygammaglutamyl hydrolase)
  • gamma-glutamyl hydrolase
  • Gamma-Glu-X carboxypeptidase
  • GH

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Growth Hormone
Antibody [Unconjugate
AF1067
Western blot shows lysates of human, mouse, and rat pituitary gland tissue. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human Growth Hormone Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1067) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Growth Hormone at approximately 22 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Recombinant Human Growth Hormone protein was serially diluted 2-fold and captured by Mouse Anti-Human Growth Hormone Monoclonal Antibody (Catalog # MAB10671) coated on a Clear Polystyrene Microplate (Catalog # DY990). Goat Anti-Human/Mouse/Rat Growth Hormone Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1067) was biotinylated and incubated with the protein captured on the plate. Detection of the standard curve was achieved by incubating Streptavidin-HRP (Catalog # DY998) followed by Substrate Solution (Catalog # DY999) and stopping the enzymatic reaction with Stop Solution (Catalog # DY994).
Recombinant Human Growth Hormone (Catalog # 1067-GH) stimulates proliferation in the Nb2‑11 rat lymphoma cell line in a dose-dependent manner (orange line). Proliferation elicited by Recombinant Human Growth Hormone (0.2 ng/mL) is neutralized (green line) by increasing concentrations of Goat Anti-Human/Mouse/Rat Growth Hormone Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1067). The ND50 is typically 1.5-7.5 ng/mL.
(3 Reviews)
(8 Publications)
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
IGF-I/IGF-1
[Unconjugated]
291-G1
1 μg/lane of Recombinant Human IGF-I/IGF-1 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 7 kDa.
Recombinant Human IGF-I/IGF-1 (Catalog # 291-G1) stimulates proliferation in the MCF-7 human breast cancer cell line. The ED50 for this effect is 0.3‑1.5 ng/mL.
MALDI-TOF analysis of Recombinant Human IGF-I/IGF-1.The major peak corresponds to the calculated molecular mass, 7650 Da. The minor peak at 7873 is a matrix-associated artifact of the MALDI-TOF.
(8 Reviews)
(153 Publications)
Species: Hu
Prolactin Antibody
[Unconjugated]
AF1445
Western blot shows lysates of mouse pituitary tissue and rat pituitary tissue. PVDF membrane was probed with 0.25 µg/mL of Goat Anti-Mouse/Rat Prolactin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1445) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Prolactin at approximately 23 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Recombinant Mouse Prolactin (Catalog # 1445-PL) stimulates proliferation in the Nb2‑11 rat lymphoma cell line in a dose-dependent manner (orange line). Proliferation elicited by Rec­ombinant Mouse Prolactin (10 ng/mL) is neutralized (green line) by increasing concen­trations of Goat Anti-Mouse/Rat Prolactin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1445). The ND50 is typically 0.25-1.0 µg/mL.
(5 Publications)
Species: Mu, Rt
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
GHRH 293T Cell
Transient Overexpress ...
H00002691-T01
Lane 1: GHRH transfected lysate (12.4 KDa) Lane 2: Non-transfected lysate.
GHRH transfected lysate.
Species: Hu
Insulin Antibody
(E2-E3 (same as INS04 ...
NBP2-34260
Western Blot: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Probing of Western blots of pancreatic lysates from control and iron overloaded Tg40 PrP and PrP-/- mice with antibodies specific for insulin dimer and pentamer (upper and lower panels) shows decreased expression in Tg40 PrP relative to PrP-/- samples (lanes 1 & 5 vs. 3 & 7). Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41598-018-24786-1), licensed under a CC-BY licence.
Immunohistochemistry: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Immunohistochemistry of pancreas shows relatively higher reactivity for insulin in PrP-/- relative to Tg40 PrP sections (panels 1 & 3). Iron overloading decreases insulin reactivity in Tg40 PrP but not in PrP-/- samples (panels 1 vs. 2 & 3 vs. 4). Reaction for glucagon is higher in iron overloaded Tg40 PrP relative to control samples (panels 5 & 6). The difference is minimal in PrP-/- samples (panels 7 & 8). Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-018-24786-1), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Formalin-fixed, paraffin-embedded human pancreas stained with insulin Monoclonal Antibody (E2-E3)
(5 Reviews)
(2 Publications)
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, ICC/IF, IHC, IHC-P
PBX1 Antibody (4A2)
H00005087-M01
Western Blot: PBX1 Antibody (4A2) [H00005087-M01] - PBX1 monoclonal antibody (M01), clone 4A2 Analysis of PBX1 expression in Hela S3 NE.
Immunocytochemistry/Immunofluorescence: PBX1 Antibody (4A2) [H00005087-M01] - Analysis of monoclonal antibody to PBX1 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: PBX1 Antibody (4A2) [H00005087-M01] - Analysis of monoclonal antibody to PBX1 on formalin-fixed paraffin-embedded human salivary gland. Antibody concentration 3 ug/ml.
(9 Publications)
Species: Hu, Mu, Pm
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA
Somatostatin
Antibody (7G5)
NBP2-37447
Western Blot: Somatostatin Antibody (7G5) [NBP2-37447] - Analysis using SST mAb against human SST recombinant protein. (Expected MW is 38.2 kDa)
Immunohistochemistry-Paraffin: Somatostatin Antibody (7G5) [NBP2-37447] - Analysis of lung cancer tissues using SST mouse mAb with DAB staining.
Flow Cytometry: Somatostatin Antibody (7G5) [NBP2-37447] - Analysis of HepG2 cells using SST mouse mAb (green) and negative control (red).
(1 Review)
(1 Publication)
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, IF
POMC Antibody
NB100-1533
Western Blot: POMC Antibody [NB100-1533] - Staining of NIH3T3 cell lysate with antibody at 0.3 ug/mL (A) and Rat Brain cell lysate with antibody at 2 ug/mL (B). 35 ug protein in RIPA buffer. Detected by chemiluminescence.
Immunohistochemistry: POMC Antibody [NB100-1533] - Representative confocal images of POMC in POMC-transfected WT and Sel1L-/- N2a cells. White arrows point to POMC-containing secretory granules, while yellow arrows point to perinuclear POMC. KDEL marks the ER. Representative data from at least 2 independent experiments are shown. Image collected and cropped by CiteAb from the following publication (jci.org/articles/view/96420), licensed under a CC-BY licence.
Flow Cytometry: POMC Antibody [NB100-1533] - Flow cytometric analysis of paraformaldehyde fixed A431 cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.
(10 Publications)
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
Thyrotropin
Releasing Hormone Ant
NBP2-95244
Western Blot: Thyrotropin Releasing Hormone Antibody [NBP2-95244] - Analysis of extracts of various cell lines, using Thyrotropin Releasing Hormone at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.
Immunocytochemistry/Immunofluorescence: Thyrotropin Releasing Hormone Antibody [NBP2-95244] - Analysis of U2OS cells using Thyrotropin Releasing Hormone at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: Thyrotropin Releasing Hormone Antibody [NBP2-95244] - Paraffin-embedded mouse brain using Thyrotropin Releasing Hormone.
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
IGFBP-3 [HRP]
DGB300
(3 Reviews)
(37 Publications)
Species: Hu
PLOD1 Antibody
NBP2-38770
Western Blot: PLOD1 Antibody [NBP2-38770] - Analysis in human cell line U-251 MG and human cell line RT-4.
Western Blot: PLOD1 Antibody [NBP2-38770] - Analysis in human cell line U-87 MG.
Western Blot: PLOD1 Antibody [NBP2-38770] - SC65 directly interacts with lysyl-hydroxylase 1 (LH1). Western blot of primary calvarial osteoblast and skin fibroblast lysates from WT and Sc65KO 3 day-old mice (N = 2) showing significantly decreased levels of LH1 protein in Sc65KO samples. Densitometric quantification of LH1 protein normalized to beta-actin from the western blot shown above (*p<0.05; error bars represent SD). All experiments were performed at least 3 times. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pgen.1006002), licensed under a CC-BY licence.
(2 Publications)
Species: Hu, Mu
Applications: WB
BRD2 Antibody
NBP1-30475
Western Blot: BRD2 Antibody [NBP1-30475] - Whole cell lysate (50 ug) from NIH 3T3 and TCMK-1 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-BRD2 antibody used for WB at 0.1 ug/ml. Detection:Chemiluminescence with an exposure time of 30 seconds.
Immunocytochemistry/Immunofluorescence: BRD2 Antibody [NBP1-30475] - Formaldehyde-fixed asynchronous HeLa cells. Antibody: Affinity purified rabbit anti- BRD2 used at a dilution of 1:100 (2 ug/mL) (left) and rabbit anti-BRD2 recombinant monoclonal used at a dilution of 1:20 (right). Detection: Red-fluorescent goat anti-rabbit IgG cross-adsorbed Antibody DyLight 594 conjugated.
Immunohistochemistry-Paraffin: BRD2 Antibody [NBP1-30475] - Section of human ovarian carcinoma. Antibody: Affinity purified rabbit anti-BRD2 (NBP1-30475). Detection: DAB
(1 Review)
(1 Publication)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Growth Hormone R
Antibody (JU01-34)
NBP2-75518
Immunocytochemistry/Immunofluorescence: Growth Hormone R Antibody (JU01-34) [NBP2-75518] - Staining Growth hormone receptor in SH-SY5Y cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Growth Hormone R Antibody (JU01-34) [NBP2-75518] - Analysis of paraffin-embedded mouse liver tissue using anti-Growth hormone receptor antibody. Counter stained with hematoxylin.
Flow Cytometry: Growth Hormone R Antibody (JU01-34) [NBP2-75518] - Analysis of MCF-7 cells with Growth hormone receptor antibody at 1/100 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC-P
IGF-II/IGF2
[Unconjugated]
292-G2
1 μg/lane of Recombinant Human IGF‑II/IGF2 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 7 kDa.
Recombinant Human IGF-II/IGF2 (Catalog # 292‑G2) stimulates cell proliferation in the MCF-7 human breast cancer cell line. The ED50 for this effect is 1.5‑6 ng/mL.
(1 Review)
(39 Publications)
Species: Hu
Ghrelin Antibody
(883622)
MAB8200
Ghrelin was detected in immersion fixed frozen sections of mouse stomach using Rat Anti-Human/Mouse Ghrelin Monoclonal Antibody (Catalog # MAB8200) at 10 µg/mL overnight at 4 °C. Tissue was stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining is shown at both 60x magnification (upper panel) and 20x magnification (lower panel). Staining was localized to cytoplasm and gastric endocrine cells, respectively. View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
Ghrelin was detected in immersion fixed paraffin-embedded sections of human stomach using Rat Anti-Human/Mouse Ghrelin Monoclonal Antibody (Catalog # MAB8200) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS017) and counterstained with hematoxylin (blue). Specific staining was localized to glandular epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(4 Publications)
Species: Hu, Mu
Applications: IHC
IGFBP-1 [Biotin]
DY871
(1 Review)
(14 Publications)
Species: Hu
Adenine Nucleotide
Translocator 2 Antibo ...
NBP2-92630
Western Blot: Adenine Nucleotide Translocator 2 Antibody [NBP2-92630] - Analysis of extracts of various cell lines, using Adenine Nucleotide Translocator 2 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.
Immunocytochemistry/Immunofluorescence: Adenine Nucleotide Translocator 2 Antibody [NBP2-92630] - Analysis of HeLa cells using Adenine Nucleotide Translocator 2. Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: Adenine Nucleotide Translocator 2 Antibody [NBP2-92630] - Paraffin-embedded rat heart using Adenine Nucleotide Translocator 2.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Glucagon Antibody
(09) - BSA Free
NBP2-21803
Immunocytochemistry/Immunofluorescence: Glucagon Antibody (09) [NBP2-21803] - Staining in human pancreas tissueSignal is strong in alpha cells. Dilution: 1:4000
Immunohistochemistry-Paraffin: Glucagon Antibody (09) [NBP2-21803] - Staining of human pancreas tissue. Alpha cells of the Langerhans islet were stained strongly. Dilution: 1:8000
Sandwich ELISA: Glucagon Antibody (09) - BSA Free [NBP2-21803] - Glucagon Antibody (09) [NBP2-21803] - The calibration curve of a sandwich assay for Glucagon using NBP2-21803 as the capture antibody and NBP2-21802B as the biotinylated detection antibody.
(3 Publications)
Species: Hu, Mu, Rt, Po
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, S-ELISA, ELISA(Cap)
Leptin/OB [HRP]
DLP00
(4 Reviews)
(110 Publications)
Species: Hu
gamma-glutamyl
hydrolase Antibody
NBP1-90927
gamma-glutamyl hydrolase Antibody
Species: Hu
Applications: WB, IHC, IHC-P

Publications for gamma-glutamyl hydrolase Antibody (NBP1-90927)(1)


Reviews for gamma-glutamyl hydrolase Antibody (NBP1-90927) (0)

There are no reviews for gamma-glutamyl hydrolase Antibody (NBP1-90927). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for gamma-glutamyl hydrolase Antibody (NBP1-90927) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional gamma-glutamyl hydrolase Products

Bioinformatics Tool for gamma-glutamyl hydrolase Antibody (NBP1-90927)

Discover related pathways, diseases and genes to gamma-glutamyl hydrolase Antibody (NBP1-90927). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for gamma-glutamyl hydrolase Antibody (NBP1-90927)

Discover more about diseases related to gamma-glutamyl hydrolase Antibody (NBP1-90927).
 

Pathways for gamma-glutamyl hydrolase Antibody (NBP1-90927)

View related products by pathway.

PTMs for gamma-glutamyl hydrolase Antibody (NBP1-90927)

Learn more about PTMs related to gamma-glutamyl hydrolase Antibody (NBP1-90927).

Blogs on gamma-glutamyl hydrolase

There are no specific blogs for gamma-glutamyl hydrolase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our gamma-glutamyl hydrolase Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol GGH