Recombinant Human iNOS GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human iNOS Protein [H00004843-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human iNOS GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 685-794 of Human iNOS

Source: Wheat Germ (in vitro)

Amino Acid Sequence: DVRGKQHIQIPKLYTSNVTWDPHHYRLVQDSQPLDLSKALSSMHAKNVFTMRLKSRQNLQSPTSSRATILVELSCEDGQGLNYLPGEHLGVCPGNQPALVQGILERVVDG

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
NOS2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Reviewed Applications
Read 1 Review rated 4
using
H00004843-Q01 in the following application:

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human iNOS GST (N-Term) Protein

  • EC 1.14.13.39
  • Hepatocyte NOS
  • HEP-NOS
  • Inducible NO synthase
  • Inducible NOS
  • iNOS
  • nitric oxide synthase 2, inducible
  • nitric oxide synthase 2A (inducible, hepatocytes)
  • nitric oxide synthase, inducible
  • nitric oxide synthase, macrophage
  • NOS type II
  • NOS
  • NOS2
  • NOS2A
  • Peptidyl-cysteine S-nitrosylase NOS2

Background

Nitric oxide (NO) is a colorless, free radical gas that carries a variety of messages between cells. Vasorelaxation, neurotransmission and cytotoxicity can all be potentiated through cellular response to NO. NO production is mediated by members of the nitric oxide synthase (NOS) family including the two constitutive isoforms: brain, bNOS, or neuronal NOS, nNOS (type I) and endothelial cell NOS, eNOS (type III); along with the inducible isoform, iNOS (type II). NOS catalyzes the oxidization of L-arginine to produce L-citrulline and NO, requiring the cofactors calmodulin, nicotinamide adenine dinucleotide phosphate (NADPH), flavin adenine dinucleotide (FAD), and flavin mononucleotide (FMN), heme, and tetrahydrobiopterin (1).

The 131 kDa enzyme, iNOS, is found in a variety of cell types including macrophages, hepatocytes, synoviocytes, and smooth muscle cells. While constitutively expressed in kidneys, in other tissues iNOS is induced by bacterial lipopolysaccharides (LPS), growth factors, and cytokines such as IFN-gamma, TNF, IL-1 and IL-2. iNOS is not regulated by the level of intracellular Ca2+ and is constantly active as a dimer when expressed. iNOS activity is elevated in a variety of diseases including atherosclerosis, heart failure, sepsis, solid tumors, and type 2 diabetes. Acting as a critical mediator of inflammation and apoptosis, iNOS inhibitors have been shown to alleviate obesity and stress inducted insulin resistance in mouse models (2,3).

References

1. Forstermann U, and Sessa WC. (2012) Nitric oxide synthases: regulation and function. Eur Heart J. 33(7): 829-837. PMID: 21890489

2. Aktan F. (2004) iNOS-mediated nitric oxide production and its regulation. Life Sci. 75(6):639-53. PMID: 15172174

3. Cinelli MA, Do HT, Miley GP, Silverman RB. (2020) Inducible nitric oxide synthase: Regulation, structure, and inhibition. Med Res Rev. 40(1):158-189. PMID: 31192483

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr, Sh
Applications: WB, IHC, IHC-Fr, IHC-P
NB100-858
Species: Hu, Mu, Rt, Gp
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, IHC-WhMt
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NB100-56583
Species: Hu, Rt, Rb
Applications: WB, Flow, IHC, IHC-P, KO
NBP1-76919
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-27084
Species: Hu, Pm
Applications: WB, IHC, IHC-P
MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
AF3667
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
NBP1-97507
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
H00004843-Q01
Species: Hu
Applications: WB, ELISA, PA, PAGE, AP

Publications for iNOS Partial Recombinant Protein (H00004843-Q01) (0)

There are no publications for iNOS Partial Recombinant Protein (H00004843-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for iNOS Partial Recombinant Protein (H00004843-Q01) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using H00004843-Q01:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot iNOS H00004843-Q01
Enlarge
4
reviewed by:
Anonymous
WB Human 11/10/2015
View

Summary

ApplicationWestern Blot
Sample Testedmast cell line lysate
SpeciesHuman

Blocking

Blocking DetailsCells were blocked with 5% milk in PBST 1 hour at RT

Primary Anitbody

Dilution RatioUsed anti-iNOS antibody from Abcam, diluted 1/500 in TBST, incubated for an hour at RT

Secondary Antibody

Secondary Descriptiongoat anti-rabbit HRP diluted 1/2000 in TBST
Secondary Manufacturer Cat#Abcam

Details

Detection NotesUsed Western blotting reagents and film to detect. Film was exposed for 2 minutes.

Comments

CommentsWe got 1 dark band at the appropriate size for this iNOS recombinant protein when using it as positive control in Western blotting assay. We got another band at around 25kD but it was faint. For our samples, we got 2 bands around 45kD, each on one side of the band for the iNOS protein. Still not sure what it means but I think this protein worked well in the assay anyhow...

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for iNOS Partial Recombinant Protein (H00004843-Q01). (Showing 1 - 1 of 1 FAQ).

  1. We need to evaluate the level of iNOS in Rat sciatic nerve by Western Blot. I see that you have few antibodies suitable for that, could you please recommend the best what you have for our purposes?
    • We have 4 iNOS antibodies that are suitable for your experiment. The best choice for you will depend on your specific preferences, in this case the main difference will be the immunogen location. If the immunogen is not important to you, then I would recommend choosing NB300-605 as it gives you the best value and we are able to provide the exact immunogen.

Other Available Formats

Additional iNOS Products

Bioinformatics Tool for iNOS Partial Recombinant Protein (H00004843-Q01)

Discover related pathways, diseases and genes to iNOS Partial Recombinant Protein (H00004843-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for iNOS Partial Recombinant Protein (H00004843-Q01)

Discover more about diseases related to iNOS Partial Recombinant Protein (H00004843-Q01).
 

Pathways for iNOS Partial Recombinant Protein (H00004843-Q01)

View related products by pathway.

PTMs for iNOS Partial Recombinant Protein (H00004843-Q01)

Learn more about PTMs related to iNOS Partial Recombinant Protein (H00004843-Q01).
 

Research Areas for iNOS Partial Recombinant Protein (H00004843-Q01)

Find related products by research area.

Blogs on iNOS.

Toll-like receptors in the intestinal epithelial cells
By Jamshed Arslan, Pharm. D., PhD. Toll-like receptors (TLRs) are microbe-sensing proteins that act as first responders to danger signals. TLRs help the intestinal epithelial cells (IECs) recognize commensal bacteria...  Read full blog post.

The effects of curcumin on IKB Alpha and the NFkB signaling pathway
The IKK complex, or inhibitor of NFkB kinase, is composed of IKK alpha and IKK beta.  These kinases are at the core of the NFkB signaling cascade.  The NFkB family is made up of transcription factors that are kept inactive in the cytoplasm through...  Read full blog post.

iNOS: The Nitric Oxide Boss
Nitric oxide (NO) is an inorganic, gaseous, and reactive free radical that acts as a biologic mediator in processes such as neurotransmission, vasorelaxation, and cytotoxicity. In addition, it has antimicrobial and anti-tumoral activities. NO producti...  Read full blog post.

Customers Who Bought This Also Bought

iNOS Antibody
NB300-605

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Anonymous
11/10/2015
Application: WB
Species: Human

Bioinformatics

Gene Symbol NOS2