E-Cadherin Antibody

Images

 
Immunohistochemistry-Paraffin: E-Cadherin Antibody [NBP1-84588] - Staining of human kidney shows membranous positivity in distal tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

E-Cadherin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ATDNGSPVATGTGTLLLILSDVNDNAPIPEPRTIFFCERNPKPQVINIIDADLPPNTSPFTAELTHGASANWTIQYNDPTQESIILKPKMALEVGDYKINLKLMDNQNKDQVTTLEVSVCDCEGA
Marker
Epithelial Cell Marker, Adherens Junctions Marker
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CDH1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Control Peptide
E-Cadherin Protein (NBP1-84588PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for E-Cadherin Antibody

  • Arc-1
  • CAD1
  • cadherin 1, E-cadherin (epithelial)
  • cadherin 1, type 1, E-cadherin (epithelial)
  • Cadherin-1
  • calcium-dependent adhesion protein, epithelial
  • CAM 120/80
  • CD324 antigen
  • CD324
  • CDH1
  • CDHE
  • cell-CAM 120/80
  • Cell-CAM120/80
  • ECAD
  • ECadherin
  • E-Cadherin
  • Epithelial cadherin
  • LCAM
  • L-CAM
  • UVOE-Cadherin
  • Uvomorulin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37578
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-15723
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-48309
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
AF4885
Species: Mu
Applications: WB, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P, ICC
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-03886
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for E-Cadherin Antibody (NBP1-84588) (0)

There are no publications for E-Cadherin Antibody (NBP1-84588).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for E-Cadherin Antibody (NBP1-84588) (0)

There are no reviews for E-Cadherin Antibody (NBP1-84588). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for E-Cadherin Antibody (NBP1-84588) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional E-Cadherin Products

Bioinformatics Tool for E-Cadherin Antibody (NBP1-84588)

Discover related pathways, diseases and genes to E-Cadherin Antibody (NBP1-84588). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for E-Cadherin Antibody (NBP1-84588)

Discover more about diseases related to E-Cadherin Antibody (NBP1-84588).
 

Pathways for E-Cadherin Antibody (NBP1-84588)

View related products by pathway.

PTMs for E-Cadherin Antibody (NBP1-84588)

Learn more about PTMs related to E-Cadherin Antibody (NBP1-84588).

Blogs on E-Cadherin.

Cathepsin B - a lysosomal protease with potential of an important drug target in neurological diseases and cancer
Cathepsins are a family of lysosomal proteases (serine, aspartic and cysteine proteases) that acts in conjunction with lipases and nucleases to degrade biological macromolecules in the lysosomes (1). While most cathepsins are ubiquitously expressed...  Read full blog post.

SOX2 - a stem cell transcription factor
The SOX gene family encodes a group of highly conserved transcription factors defined by the presence of a conserved high motility group (HMG) DNA-binding domain. They are involved in embryonic development regulation and cell fate determination. Al...  Read full blog post.

Beta-catenin - I am versatile!
Beta-catenin is a cytosolic, 88 kDa intracellular protein associated with cell surface cadherin glycoproteins. It is a member of the larger calcium-dependent catenin family that includes alpha-catenin, beta-catenin, and gamma-catenin (also known as pl...  Read full blog post.

Vimentin: Regulating EMT and Cancer
Vimentin, a member of the intermediate filament (IF) family, is a protein responsible for maintaining cellular integrity and reducing damage caused by stress. The vimentin protein is ubiquitously expressed in normal mesenchymal cells, and recent resea...  Read full blog post.

Carbonic Anhydrase IX Roles in Tumor Growth, Survival and Invasion
Carbonic anhydrase IX (CAIX) is a membrane-associated carbonic anhydrase, strongly induced by hypoxia. CA IX is overexpressed by several cancer cells from many tumor types, and is a component of the pH regulatory system invoked by these cells to comba...  Read full blog post.

E-Cadherin as a Cancer Biomarker
E-cadherin is a calcium-regulated adhesion molecule expressed in most normal epithelial tissues. E-cadherin is also associated with gland formation, stratification, and epithelial polarization, while loss of E-cadherin can cause dedifferentiation and...  Read full blog post.

E-Cadherin in Cell-Cell Adhesion and Cancer Diagnostics
E-Cadherin is a member of the cadherin superfamily and is fundamental player in a wide range of cellular processes such as development, morphology, polarity, migration and tissue integrity. Specifically, E-cadherin is an approximately 100 kDa epitheli...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our E-Cadherin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CDH1
Entrez