| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ATDNGSPVATGTGTLLLILSDVNDNAPIPEPRTIFFCERNPKPQVINIIDADLPPNTSPFTAELTHGASANWTIQYNDPTQESIILKPKMALEVGDYKINLKLMDNQNKDQVTTLEVSVCDCEGA |
| Marker | Epithelial Cell Marker, Adherens Junctions Marker |
| Specificity | Specificity of human E-Cadherin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CDH1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Diseases for E-Cadherin Antibody (NBP1-84588)Discover more about diseases related to E-Cadherin Antibody (NBP1-84588).
| Pathways for E-Cadherin Antibody (NBP1-84588)View related products by pathway.
|
PTMs for E-Cadherin Antibody (NBP1-84588)Learn more about PTMs related to E-Cadherin Antibody (NBP1-84588).
|
|
Suppressing breast cancer metastasis: The role of hypoxia-induced RhoB expression and activation By Jamshed Arslan, Pharm. D., PhD. The Ras homologous (Rho) GTPase family of signaling molecules has over 20 members, which typically cycle between active (GTP-bound) and inactive (GDP-bound) states. These small GTPa... Read full blog post. |
|
Cathepsin B - a lysosomal protease with potential of an important drug target in neurological diseases and cancer Cathepsins are a family of lysosomal proteases (serine, aspartic and cysteine proteases) that acts in conjunction with lipases and nucleases to degrade biological macromolecules in the lysosomes (1). While most cathepsins are ubiquitously expressed... Read full blog post. |
|
SOX2 - a stem cell transcription factor The SOX gene family encodes a group of highly conserved transcription factors defined by the presence of a conserved high motility group (HMG) DNA-binding domain. They are involved in embryonic development regulation and cell fate determination. Al... Read full blog post. |
|
Beta-catenin - I am versatile! Beta-catenin is a cytosolic, 88 kDa intracellular protein associated with cell surface cadherin glycoproteins. It is a member of the larger calcium-dependent catenin family that includes alpha-catenin, beta-catenin, and gamma-catenin (also known as pl... Read full blog post. |
|
Vimentin: Regulating EMT and Cancer Vimentin, a member of the intermediate filament (IF) family, is a protein responsible for maintaining cellular integrity and reducing damage caused by stress. The vimentin protein is ubiquitously expressed in normal mesenchymal cells, and recent resea... Read full blog post. |
|
Carbonic Anhydrase IX Roles in Tumor Growth, Survival and Invasion Carbonic anhydrase IX (CAIX) is a membrane-associated carbonic anhydrase, strongly induced by hypoxia. CA IX is overexpressed by several cancer cells from many tumor types, and is a component of the pH regulatory system invoked by these cells to comba... Read full blog post. |
|
E-Cadherin as a Cancer Biomarker E-cadherin is a calcium-regulated adhesion molecule expressed in most normal epithelial tissues. E-cadherin is also associated with gland formation, stratification, and epithelial polarization, while loss of E-cadherin can cause dedifferentiation and... Read full blog post. |
|
E-Cadherin in Cell-Cell Adhesion and Cancer Diagnostics E-Cadherin is a member of the cadherin superfamily and is fundamental player in a wide range of cellular processes such as development, morphology, polarity, migration and tissue integrity. Specifically, E-cadherin is an approximately 100 kDa epitheli... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CDH1 |