SLC22A3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SLC22A3 Antibody [NBP1-83976] - Immunofluorescent staining of human cell line A549 shows localization to cytosol & vesicles.
Immunohistochemistry-Paraffin: SLC22A3 Antibody [NBP1-83976] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC22A3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SPRWLITRKKGDKALQILRRIAKCNGKYLSSNYSEITVTDEEVSNPSF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC22A3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval method is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SLC22A3 Protein (NBP1-83976PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC22A3 Antibody

  • EMTEMTH
  • Extraneuronal monoamine transporter
  • OCT3EMT organic cation transporter 3
  • Organic cation transporter 3
  • solute carrier family 22 (extraneuronal monoamine transporter), member 3
  • solute carrier family 22 member 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-03886
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP2-37364
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, ICC
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NBP1-91258
Species: Hu, Mu, Bv
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
MAB2018
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
NBP1-05987
Species: Hu, Mu, Rt
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
AF1997
Species: Hu
Applications: WB, ChIP, ICC
H00388112-B01P
Species: Hu
Applications: WB, ELISA
NBP1-48309
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-51684
Species: Hu, Mu
Applications: WB, ELISA, Flow
NBP1-82991
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-83976
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for SLC22A3 Antibody (NBP1-83976) (0)

There are no publications for SLC22A3 Antibody (NBP1-83976).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC22A3 Antibody (NBP1-83976) (0)

There are no reviews for SLC22A3 Antibody (NBP1-83976). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SLC22A3 Antibody (NBP1-83976) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC22A3 Products

Bioinformatics Tool for SLC22A3 Antibody (NBP1-83976)

Discover related pathways, diseases and genes to SLC22A3 Antibody (NBP1-83976). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC22A3 Antibody (NBP1-83976)

Discover more about diseases related to SLC22A3 Antibody (NBP1-83976).
 

Pathways for SLC22A3 Antibody (NBP1-83976)

View related products by pathway.

PTMs for SLC22A3 Antibody (NBP1-83976)

Learn more about PTMs related to SLC22A3 Antibody (NBP1-83976).

Blogs on SLC22A3

There are no specific blogs for SLC22A3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC22A3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC22A3
Entrez
Uniprot