SLC22A3 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: SLC22A3 Antibody [NBP1-83976] - Immunofluorescent staining of human cell line A549 shows localization to cytosol & vesicles.

Immunohistochemistry-Paraffin: SLC22A3 Antibody [NBP1-83976] - Staining of human liver shows weak to moderate cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: SLC22A3 Antibody [NBP1-83976] - Staining of human prostate shows strong membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: SLC22A3 Antibody [NBP1-83976] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

Immunohistochemistry-Paraffin: SLC22A3 Antibody [NBP1-83976] - Staining of human fallopian tube shows moderate membranous and cytoplasmic positivity in glandular cells.

IHC staining was used to validate single-nuclei RNA-seq data. a snRNA-seq harmony UMAP expression profile of endoneurial fibroblast marker LAMA2.b LAMA2 protein expression in 2 PN samples. c snRNA-seq harmony UMAP gene expression of perineurial fibroblast marker SLC22A. d SLC22A3 expression in 2 PN samples. e snRNA-seq UMAP expression of epineurial fibroblast marker PRRX1. f Representative H&E of classic PN morphology. f+ Zoomed in magnification of region of interest containing endoneurial, perineurial and epineurial zones. g PRRX1 protein expression in zoomed in region of interest. h SOX10 protein expression in same zoomed in region of interest. i snRNA-seq harmony UMAP expression profile of SOX10. j Representative H&E of second region of classic PN morphology in another patient. k SOX10 protein expression in region of interest Image collected and cropped by CiteAb from the following open publication (//pubmed.ncbi.nlm.nih.gov/37770931), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

IHC staining was used to validate single-nuclei RNA-seq data. a snRNA-seq harmony UMAP expression profile of endoneurial fibroblast marker LAMA2.b LAMA2 protein expression in 2 PN samples. c snRNA-seq harmony UMAP gene expression of perineurial fibroblast marker SLC22A. d SLC22A3 expression in 2 PN samples. e snRNA-seq UMAP expression of epineurial fibroblast marker PRRX1. f Representative H&E of classic PN morphology. f+ Zoomed in magnification of region of interest containing endoneurial, perineurial and epineurial zones. g PRRX1 protein expression in zoomed in region of interest. h SOX10 protein expression in same zoomed in region of interest. i snRNA-seq harmony UMAP expression profile of SOX10. j Representative H&E of second region of classic PN morphology in another patient. k SOX10 protein expression in region of interest Image collected and cropped by CiteAb from the following open publication (//pubmed.ncbi.nlm.nih.gov/37770931), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SLC22A3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SPRWLITRKKGDKALQILRRIAKCNGKYLSSNYSEITVTDEEVSNPSF
• Predicted Species: Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC22A3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval method is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SLC22A3 Protein (NBP1-83976PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SLC22A3 Antibody - BSA Free

• EMTEMTH
• EMTH
• Extraneuronal monoamine transporter
• OCT3
• OCT3EMT organic cation transporter 3
• Organic cation transporter 3
• SLC22A3
• solute carrier family 22 (extraneuronal monoamine transporter), member 3
• solute carrier family 22 member 3

Background

SLC22A3 - solute carrier family 22 (extraneuronal monoamine transporter), member 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SLC22A3 Antibody (NBP1-83976)(2)

Publications using NBP1-83976

• Lee B, Xing X, Hammes E et al. Signaling by intracellular beta 2 -adrenergic receptors regulates AMPA receptor trafficking and synaptic plasticity. Cell reports 2025-08-29 [PMID: 40679912]
• Amani V, Riemondy KA, Fu R et al. Integration of single-nuclei RNA-sequencing, spatial transcriptomics and histochemistry defines the complex microenvironment of NF1-associated plexiform neurofibromas Acta Neuropathol Commun 2023-09-28 [PMID: 37770931] (Immunohistochemistry, Immunohistochemistry-Paraffin)

Bioinformatics

• Gene Symbol: SLC22A3
• Entrez:
  • 6581(Human)
• Uniprot:
  • O75751(Human)