SLC22A3 Antibody

Immunocytochemistry/Immunofluorescence: SLC22A3 Antibody [NBP1-83976] - Immunofluorescent staining of human cell line A549 shows localization to cytosol & vesicles.

Immunohistochemistry-Paraffin: SLC22A3 Antibody [NBP1-83976] - Staining of human liver shows weak to moderate cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: SLC22A3 Antibody [NBP1-83976] - Staining of human prostate shows strong membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: SLC22A3 Antibody [NBP1-83976] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

Immunohistochemistry-Paraffin: SLC22A3 Antibody [NBP1-83976] - Staining of human fallopian tube shows moderate membranous and cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

SLC22A3 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SPRWLITRKKGDKALQILRRIAKCNGKYLSSNYSEITVTDEEVSNPSF
• Predicted Species: Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC22A3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval method is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SLC22A3 Protein (NBP1-83976PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SLC22A3 Antibody

• EMTEMTH
• EMTH
• Extraneuronal monoamine transporter
• OCT3
• OCT3EMT organic cation transporter 3
• Organic cation transporter 3
• SLC22A3
• solute carrier family 22 (extraneuronal monoamine transporter), member 3
• solute carrier family 22 member 3

Background

SLC22A3 - solute carrier family 22 (extraneuronal monoamine transporter), member 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC22A3
• Entrez:
  • 6581(Human)
• Uniprot:
  • O75751(Human)