Tight Junction Protein 1 Antibody

Images

 
Genetic Strategies: Knockout Validated: Tight Junction Protein 1 Antibody [NBP1-85047] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and TJP1 knockout (KO) HeLa cell ...read more
Immunocytochemistry/ Immunofluorescence: Tight Junction Protein 1 Antibody [NBP1-85047] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & cell junctions. Antibody staining is shown ...read more
Orthogonal Strategies: Immunohistochemistry-Paraffin: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining in human testis and skeletal muscle tissues. Corresponding TJP1 RNA-seq data are presented for the ...read more
Immunocytochemistry/ Immunofluorescence: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining of Pig trabecular meshwork cells. Image from verified customer review.
Immunohistochemistry-Paraffin: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining of human kidney shows strong membranous positivity in cells in glomeruli.
Immunohistochemistry-Paraffin: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining of human placenta shows moderate membranous positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining of human skeletal muscle shows no membranous positivity in myocytes as expected.
Immunohistochemistry-Paraffin: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining of human testis shows moderate to strong membranous positivity in cells in seminiferous ducts.
Simple Western: Tight Junction Protein 1 Antibody [NBP1-85047] - Simple Western lane view shows a specific band for TJP1 in 0.2 mg/ml of HeLa lysate. This experiment was performed under reducing conditions using the ...read more

Product Details

Summary
Reactivity Hu, Po, Mu, RtSpecies Glossary
Applications Simple Western, ICC/IF, IHC, IHC-P, KO
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Tight Junction Protein 1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RKLYERSHKLRKNNHHLFTTTINLNSMNDGWYGALKEAIQQQQNQLVWVSEGKADGATSDDLDLHDDRLSYLSAPGSEYSMYSTDSRHTSDYEDTDTEGGAYTDQELDETLNDEVGTPPESAITRSSEPVRED
Marker
Intercellular Junctions/Tight Junction Marker
Specificity
Specificity of human, porcine Tight Junction Protein 1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TJP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Simple Western 1:20
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockout Validated 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
Positive Control
Tight Junction Protein 1 Lysate (NBP2-64788)
Control Peptide
Tight Junction Protein 1 Protein (NBP1-85047PEP)
Reviewed Applications
Read 4 Reviews rated 4.5
using
NBP1-85047 in the following applications:

Publications
Read Publications using
NBP1-85047 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24300555). Porcine reactivity per customer review.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Tight Junction Protein 1 Antibody

  • DKFZp686M05161
  • MGC133289
  • tight junction protein 1 (zona occludens 1)
  • Tight junction protein 1
  • tight junction protein ZO-1
  • TJP1
  • ZO1
  • ZO-1
  • zona occludens 1
  • Zona occludens protein 1
  • zonula occludens 1 protein
  • Zonula occludens protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87402
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-87402
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KD
H00009076-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-85683
Species: Hu
Applications: IHC, IHC-P
NBP2-02259
Species: Hu, Po
Applications: Flow, ICC/IF, ICC
NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, ICC
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
MAB4219
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-86850
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4620
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ICC
NBP2-49230
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58264
Species: Hu
Applications: ICC/IF
NBP2-38696
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-00594
Species: Hu
Applications: WB, Flow, IHC, IHC-P

Publications for Tight Junction Protein 1 Antibody (NBP1-85047)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(2)
All Species

Reviews for Tight Junction Protein 1 Antibody (NBP1-85047) (4) 4.54

Average Rating: 4.5
(Based on 4 reviews)
We have 4 reviews tested in 3 species: Human, Mouse, Other.

Reviews using NBP1-85047:
Filter by Applications
ICC
(2)
WB
(1)
ICC/IF
(1)
All Applications
Filter by Species
Human
(1)
Mouse
(2)
Other
(1)
All Species
Images Ratings Applications Species Date Details
Immunocytochemistry Tight Junction Protein 1 NBP1-85047
Enlarge
reviewed by:
Fabio Marongiu
ICC Human 08/29/2017
View

Summary

ApplicationImmunocytochemistry
Sample TestedARPE-19 cells
SpeciesHuman
LotC105864

Comments

CommentsFixative 4% PFA
Blocking Goat Serum
Dilution 1:200
Incubation 1h @ RT
Western Blot Tight Junction Protein 1 NBP1-85047
Enlarge
reviewed by:
Jim Hsiao
WB Mouse 06/22/2017
View

Summary

ApplicationWestern Blot
Sample TestedPrimary Mouse Lung cells
SpeciesMouse
Immunocytochemistry/Immunofluorescence Tight Junction Protein 1 NBP1-85047
Enlarge
reviewed by:
Jim Hsiao
ICC/IF Mouse 10/13/2016
View

Summary

ApplicationImmunocytochemistry/Immunofluorescence
Sample TestedPrimary mouse lung endotelial cells
SpeciesMouse
LotB10562
Immunocytochemistry Tight Junction Protein 1 NBP1-85047
Enlarge
reviewed by:
Anonymous
ICC Other 02/02/2016
View

Summary

ApplicationImmunocytochemistry
Sample TestedPig trabecular meshwork cells
SpeciesOther

Blocking

Blocking Detailsn/a

Details

Detection Notesn/a

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Tight Junction Protein 1 Antibody (NBP1-85047) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Tight Junction Protein 1 Antibody (NBP1-85047)

Discover related pathways, diseases and genes to Tight Junction Protein 1 Antibody (NBP1-85047). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Tight Junction Protein 1 Antibody (NBP1-85047)

Discover more about diseases related to Tight Junction Protein 1 Antibody (NBP1-85047).
 

Pathways for Tight Junction Protein 1 Antibody (NBP1-85047)

View related products by pathway.

PTMs for Tight Junction Protein 1 Antibody (NBP1-85047)

Learn more about PTMs related to Tight Junction Protein 1 Antibody (NBP1-85047).

Blogs on Tight Junction Protein 1.

Zonula Occludens (ZO) the Junction Scaffolding Proteins
The Zonula Occludens (ZO) proteins 1,2 and 3, also known as tight junction proteins, are peripheral proteins localizing at junctional sites(1). ZO proteins are known to be scaffolding proteins recruiting various types of proteins to the cytoplasmic...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4.5
5
2
4
2
3
0
2
0
1
0

Fabio Marongiu
08/29/2017
Application: ICC
Species: Human

Jim Hsiao
06/22/2017
Application: WB
Species: Mouse

Jim Hsiao
10/13/2016
Application: ICC/IF
Species: Mouse

Bioinformatics

Gene Symbol TJP1