Collagen I alpha 1 Antibody - Azide and BSA Free

Images

 
Western Blot: Collagen I alpha 1 Antibody [NBP2-92877] - Analysis of extracts of various cell lines, using Collagen I/COL1A1 antibody at 1:2680 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 ...read more
Immunohistochemistry-Paraffin: Collagen I alpha 1 Antibody [NBP2-92877] - Human breast cancer using Collagen I/COL1A1 Rabbit pAb at dilution of 1:10000 (40x lens).Perform high pressure antigen retrieval with 10 mM ...read more
Immunohistochemistry-Paraffin: Collagen I alpha 1 Antibody [NBP2-92877] - Human colon using Collagen I/COL1A1 Rabbit pAb at dilution of 1:10000 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate ...read more
Immunocytochemistry/ Immunofluorescence: Collagen I alpha 1 Antibody - Azide and BSA Free [NBP2-92877] - Immunofluorescence analysis of NIH/3T3 cells using Collagen I alpha 1 Rabbit pAb at dilution of 1:200 (40x lens). ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
Azide and BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

Collagen I alpha 1 Antibody - Azide and BSA Free Summary

Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1100-1200 of human Collagen I alpha 1 (NP_000079.2). GEQGDRGIKGHRGFSGLQGPPGPPGSPGEQGPSGASGPAGPRGPPGSAGAPGKDGLNGLPGPIGPPGPRGRTGDAGPVGPPGPPGPPGPPGPPSAGFDFSF
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
COL1A1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA Recommended starting concentration is 1 μg/mL.
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:2000 - 1:10000
  • Immunohistochemistry-Paraffin
  • Western Blot 1:1000 - 1:5000
Theoretical MW
138 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Collagen I alpha 1 Antibody - Azide and BSA Free

  • Alpha-1 type I collagen
  • COL1A1
  • COL-IA1
  • Collagen 1 alpha 1
  • Collagen 1
  • collagen alpha 1 chain type I
  • collagen alpha-1(I) chain
  • Collagen I alpha 1
  • collagen of skin, tendon and bone, alpha-1 chain
  • Collagen Type I Alpha 1 Chain
  • collagen, type I, alpha 1
  • Collagen1
  • Collagen-1
  • EDSARTH1
  • OI4
  • pro-alpha-1 collagen type 1
  • Type I Procollagen Alpha 1 Chain

Background

Collagen is an extracellular matrix protein that serves as a scaffold defining the shape and mechanical properties of many tissues and organs including skin, tendon, artery walls, fibrocartilage, bone and teeth. Collagens are highly conserved and are characterized by an uninterrupted "Glycine X Y" triplet repeat that is a necessary part of the triple helical structure. The extensive family of collagens is composed of several chain types, including fibril-forming interstitial collagens (types I, II, III and V) and basement membrane collagens (type IV), each type containing multiple isoforms. Collagen type I (also known as collagen alpha, COL1A1, and alpha-1 type I collagen) is the largest component of fibrillar collagen found in cartilage and connective tissues. It is synthesized by fibroblasts, osteoblasts, and odontoblasts and has a theoretical molecular weight of 138 kDa.

Type I collagen is a fibril-forming collagen found in most connective tissues and is abundant in bone, cornea, dermis and tendon tissue. Collagens are fibrous, extracellular matrix proteins with high tensile strength and are the major components of connective tissue. Several collagens play a role in cell adhesion, responsible for maintaining normal tissue architecture and function. All collagens contain a triple helix domain and frequently show lateral self-association in order to form complex connective tissues. Post-Golgi LH3 trafficking is essential for collagen homeostasis and for the development and function of multiple organs and tissues (1).

The COL1A1 gene encodes the pro-alpha1 chains of type I collagen protein, whose triple helix is comprised of two alpha1 chains and one alpha2 chain. Mutations in the encoding COL1A1 gene are associated with brittle bone disease (Osteogenesis Imperfecta), cortical hyperostosis (Caffey disease) and disorders that affect the connective tissues (Ehlers-Danlos syndrome) (2). Studies have found that HIF-1 transcription regulation of collagen prolyl hydroxylases regulates collagen deposition, promoting cancer cell alignment along collagen fibers, which enhances invasion and metastasis to lymph nodes and lung tissue by breast cancer cells (3).

References

1. Banushi, B., Forneris, F., Straatman-Iwanowska, A., Strange, A., Lyne, A. M., Rogerson, C., . . . Gissen, P. (2016). Regulation of post-Golgi LH3 trafficking is essential for collagen homeostasis. Nat Commun, 7, 12111. doi:10.1038/ncomms12111

2. Lu, Y., Zhang, S., Wang, Y., Ren, X., & Han, J. (2019). Molecular mechanisms and clinical manifestations of rare genetic disorders associated with type I collagen. Intractable Rare Dis Res, 8(2), 98-107. doi:10.5582/irdr.2019.01064

3. Gilkes, D. M., Chaturvedi, P., Bajpai, S., Wong, C. C., Wei, H., Pitcairn, S., . . . Semenza, G. L. (2013). Collagen prolyl hydroxylases are essential for breast cancer metastasis. Cancer Res, 73(11), 3285-3296. doi:10.1158/0008-5472.Can-12-3963

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-92790
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB600-594
Species: Bv, Fe, Hu, Mu, Rt, Sh
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
MAB1419
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
NB600-844
Species: Ch, Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NB600-232
Species: Hu, Mu
Applications: ChIP, IHC,  IHC-P, IP, WB
DPSG10
Species: Hu
Applications: ELISA
3047-CC
Species: Hu
Applications: BA
NBP1-89953
Species: Hu, Mu
Applications: IHC,  IHC-P
NB300-164
Species: Ca, Hu, Mu, Po, Pm, Rt(-)
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KO, PLA, WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
AF808
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
M6000B
Species: Mu
Applications: ELISA
220-BB
Species: Hu
Applications: BA
MAB7665
Species: Hu
Applications: IHC, WB
7754-BH/CF
Species: Hu
Applications: BA
355-BM
Species: Hu, Mu, Rt
Applications: BA
291-G1
Species: Hu
Applications: BA
NB100-74350
Species: Bv, Ca, Hu, Mu, Po, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-92877
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC

Publications for Collagen I alpha 1 Antibody (NBP2-92877) (0)

There are no publications for Collagen I alpha 1 Antibody (NBP2-92877).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Collagen I alpha 1 Antibody (NBP2-92877) (0)

There are no reviews for Collagen I alpha 1 Antibody (NBP2-92877). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Collagen I alpha 1 Antibody (NBP2-92877). (Showing 1 - 4 of 4 FAQ).

  1. We are looking for an anti-Collagen antibody for Flow Cytometry (FACS) analysis in Swine sample. Would you please provide some references if there is any available as well?
    • We currently have one antibody for porcine Collagen validated in flow cytometry (catalog # NBP1-94202).
  2. I am looking for anti collagen 1 antibody, I see your product calls it collagen I alpha 1 is there a difference?
    • Collagen I alpha 1 is the most common protein for the collagen 1 protein. There are other subunits as well (such as collagen 1 alpha 2…etc.).
  3. The predicted molecular weight says 150kDA but the band on the gel appears at 130kDA why is that?
    • Differences between the predicted and observed MW can be affected by a number of factors including PTMs, relative charges and experimental factors. These cumulative effect of these differences can be quite substantial with larger molecules such as collagen I alpha 1.
  4. How long does delivery take for your collagen 1 alpha 1 antibody?
    • Our most popular collagen I alpha 1 antibody (NB600-408) is usually in stock and ships priority overnight for next business day delivery in the U.S.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Collagen I alpha 1 Antibody - Azide and BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol COL1A1