COL1A2 Antibody

Western Blot: COL1A2 Antibody [NBP2-92790] - Analysis of extracts of A375 cells, using Collagen I/COL1A2 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit. Exposure time: 180s.

Immunocytochemistry/Immunofluorescence: COL1A2 Antibody [NBP2-92790] - Analysis of NIH/3T3 cells using Collagen I/COL1A2 antibody at dilution of 1:25. Blue: DAPI for nuclear staining.

Immunohistochemistry-Paraffin: COL1A2 Antibody [NBP2-92790] - Human placenta using Collagen I/COL1A2 Rabbit pAb (A5786) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunocytochemistry/Immunofluorescence: COL1A2 Antibody [NBP2-92790] - Analysis of A-431 cells using Collagen I/COL1A2 antibody at dilution of 1:25. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

COL1A2 Antibody Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 500-600 of human COL1A2 (NP_000080.2). PTGDPGKNGDKGHAGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPPGPPGFQGLPGPSGPAGEVGKPGERGLHGEFGLPGPAGPRGERGPPGESGAA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: COL1A2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 1:25-1:200
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500-1:2000
• Theoretical MW: 129 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS with 50% glycerol, pH7.3.
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for COL1A2 Antibody

• alpha 2(I)-collagen
• Alpha-2 type I collagen
• collagen alpha-2(I) chain
• collagen I, alpha-2 polypeptide
• collagen of skin, tendon and bone, alpha-2 chain
• collagen, type I, alpha 2
• OI4
• osteogenesis imperfecta type IV
• type I procollagen

Background

The extensive family of COL gene products (collagens) is composed of several chain types, including fibril-forming interstitial collagens (types I, II, III and V) and basement membrane collagens (type IV), each type containing multiple isoforms. Collagens are fibrous, extracellular matrix proteins with high tensile strength and are the major components of connective tissue, such as tendons and cartilage. All collagens contain a triple helix domain and frequently show lateral self-association in order to form complex connective tissues. Several collagens also play a role in cell adhesion, important for maintaining normal tissue architecture and function.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: COL1A2