Osteocalcin Antibody (190125)

Osteocalcin was detected in immersion fixed MG‑63 human osteosarcoma cell line using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.

Osteocalcin was detected in human mesenchymal stem cells differentiated into osteocytes using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.

Osteocalcin was detected in immersion fixed rat osteocytes differentiated from mesenchymal stem cells using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.

Osteocalcin was detected in immersion fixed paraffin-embedded sections of human cartilage using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 8 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Specific labeling was localized to the cytoplasm of chondrocytes. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.

Osteocalcin was detected in immersion fixed paraffin-embedded sections of human osteosarcoma using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 25 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.

Saos‑2 human osteosarcoma cell line was stained with Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419, filled histogram) or isotype control antibody (Catalog # MAB002, open histogram), followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.

Human osteoblasts were stained with Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419, filled histogram) or isotype control antibody (Catalog # MAB002, open histogram), followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.

• Reactivity: Hu, Rt
• Applications: IHC, CyTOF-ready, Flow, ICC/IF
• Clone: 190125
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Concentration: LYOPH

Osteocalcin Antibody (190125) Summary

• Immunogen: Human Osteocalcin synthetic peptide
  YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
  Accession # P02818
• Specificity: Detects human Osteocalcin in direct ELISAs.
• Source: N/A
• Isotype: IgG1
• Clonality: Monoclonal
• Host: Mouse
• Gene: BGLAP
• Purity: Protein A or G purified from hybridoma culture supernatant
• Purity Statement: Protein A or G purified from hybridoma culture supernatant

Applications/Dilutions

• Dilutions:
  • CyTOF-ready
  • Immunocytochemistry 8-25 ug/mL
  • Immunohistochemistry 8-25 ug/mL
  • Intracellular Staining by Flow Cytometry 2.5 ug/10^6 cells

Packaging, Storage & Formulations

• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles.
  • 12 months from date of receipt, -20 to -70 °C as supplied.
  • 1 month, 2 to 8 °C under sterile conditions after reconstitution.
  • 6 months, -20 to -70 °C under sterile conditions after reconstitution.
• Buffer: Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied either lyophilized or as a 0.2 µm filtered solution in PBS.
• Preservative: No Preservative
• Concentration: LYOPH
• Purity: Protein A or G purified from hybridoma culture supernatant
• Reconstitution Instructions: Reconstitute at 0.5 mg/mL in sterile PBS.

Notes

This product is produced by and ships from R&D Systems, Inc., a Bio-Techne brand.

Alternate Names for Osteocalcin Antibody (190125)

• BGLAP
• BGP
• bone gamma-carboxyglutamate (gla) protein (osteocalcin)
• bone gamma-carboxyglutamate (gla) protein
• Bone Gla protein
• Gamma-carboxyglutamic acid-containing protein
• OC
• OCN
• Osteocalcin

Background

Osteocalcin, also known as Bone gamma -Carboxyglutamic Acid Protein, is a secreted protein whose expression is restricted to cells of the osteoblast lineage (1). It has been frequently used as a marker for osteoblast lineage cells.

1. Lian, J.B. et al. (1999) Vitamin. Horm. 55:443.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Osteocalcin Antibody (MAB1419)(36)

Publications using MAB1419

• SK Grissom, SA Semevolos, K Duesterdie Role of cartilage and bone matrix regulation in early equine osteochondrosis Bone Reports, 2023-01-05;18(0):101653. 2023-01-05 [PMID: 36632355] (IHC, Equine)
• NT Chan, MS Lee, Y Wang, J Galipeau, WJ Li, W Xu CTR9 drives osteochondral lineage differentiation of human mesenchymal stem cells via epigenetic regulation of BMP-2 signaling Science Advances, 2022-11-16;8(46):eadc9222. 2022-11-16 [PMID: 36383652] (ICC, Human)
• X Zhang, W Jiang, C Xie, X Wu, Q Ren, F Wang, X Shen, Y Hong, H Wu, Y Liao, Y Zhang, R Liang, W Sun, Y Gu, T Zhang, Y Chen, W Wei, S Zhang, W Zou, H Ouyang Msx1+ stem cells recruited by bioactive tissue engineering graft for bone regeneration Nature Communications, 2022-09-05;13(1):5211. 2022-09-05 [PMID: 36064711] (IHC, Rat)
• M Giner, MA Vázquez-Gá, MJ Miranda, J Bocio-Nuñe, FJ Olmo-Monte, MA Rico, MA Colmenero, MJ Montoya-Ga Circulating Osteogenic Progenitor Cells Enhanced with Teriparatide or Denosumab Treatment Journal of Clinical Medicine, 2022-08-14;11(16):. 2022-08-14 [PMID: 36012987] (Flow Cytometry, Human)
• JP Ribeiro, RMA Domingues, PS Babo, LP Nogueira, JE Reseland, RL Reis, M Gomez-Flor, ME Gomes Highly elastic and bioactive bone biomimetic scaffolds based on platelet lysate and biomineralized cellulose nanocrystals Carbohydrate polymers, 2022-05-20;292(0):119638. 2022-05-20 [PMID: 35725198] (IHC, Human)
• B Zhang, M Xiao, X Cheng, Y Bai, H Chen, Q Yu, L Qiu Enamel Matrix Derivative Enhances the Odontoblastic Differentiation of Dental Pulp Stem Cells via Activating MAPK Signaling Pathways Stem Cells International, 2022-04-28;2022(0):2236250. 2022-04-28 [PMID: 35530415] (IHC, Mouse)
• NA Luchman, R Megat Abdu, SH Zainal Ari, NS Nasruddin, SF Lau, F Yazid Comparison between hydroxyapatite and polycaprolactone in inducing osteogenic differentiation and augmenting maxillary bone regeneration in rats PeerJ, 2022-05-02;10(0):e13356. 2022-05-02 [PMID: 35529494] (IHC, Rat)
• S Martin-Igl, L Milian, M Sancho-Tel, R Salvador-C, JJ Martín de, C Carda, M Mata BMP-2 Enhances Osteogenic Differentiation of Human Adipose-Derived and Dental Pulp Stem Cells in 2D and 3D In Vitro Models Stem Cells International, 2022-03-04;2022(0):4910399. 2022-03-04 [PMID: 35283997] (ICC, Human)
• Q Heydt, C Xintaropou, A Clear, M Austin, I Pislariu, F Miraki-Mou, P Cutillas, K Korfi, M Calaminici, W Cawthorn, K Suchacki, A Nagano, JG Gribben, M Smith, JD Cavenagh, H Oakervee, A Castleton, D Taussig, B Peck, A Wilczynska, L McNaughton, D Bonnet, F Mardakheh, B Patel Adipocytes disrupt the translational programme of acute lymphoblastic leukaemia to favour tumour survival and persistence Nature Communications, 2021-09-17;12(1):5507. 2021-09-17 [PMID: 34535653] (ICC/IF, Human)
• L E, R Lu, J Sun, H Li, W Xu, H Xing, X Wang, T Cheng, S Zhang, X Ma, R Zhang, H Liu Microenvironment Influences on Human Umbilical Cord Mesenchymal Stem Cell-Based Bone Regeneration Stem Cells International, 2021-08-17;2021(0):4465022. 2021-08-17 [PMID: 34447439] (ICC, Human)
• S Lv, J Xu, L Chen, H Wu, W Feng, Y Zheng, P Li, H Zhang, L Zhang, G Chi, Y Li MicroRNA-27b targets CBFB to inhibit differentiation of human bone marrow mesenchymal stem cells into hypertrophic chondrocytes Stem Cell Res Ther, 2020-09-11;11(1):392. 2020-09-11 [PMID: 32917285] (IHC, Rat)
• C Liang, Z Liu, M Song, W Li, Z Wu, Z Wang, Q Wang, S Wang, K Yan, L Sun, T Hishida, Y Cai, JCI Belmonte, P Guillen, P Chan, Q Zhou, W Zhang, J Qu, GH Liu Stabilization of heterochromatin by CLOCK promotes stem cell rejuvenation and cartilage regeneration Cell Res., 2020-07-31;0(0):. 2020-07-31 [PMID: 32737416] (ICC, Human)
• J Chen, C Tu, X Tang, H Li, J Yan, Y Ma, H Wu, C Liu The combinatory effect of sinusoidal electromagnetic field and VEGF promotes osteogenesis and angiogenesis of mesenchymal stem cell-laden PCL/HA implants in a rat subcritical cranial defect Stem Cell Res Ther, 2019-12-16;10(1):379. 2019-12-16 [PMID: 31842985] (ICC, Rat)
• V Miceli, M Pampalone, S Vella, AP Carreca, G Amico, PG Conaldi Comparison of Immunosuppressive and Angiogenic Properties of Human Amnion-Derived Mesenchymal Stem Cells between 2D and 3D Culture Systems Stem Cells Int, 2019-02-18;2019(0):7486279. 2019-02-18 [PMID: 30911299] (ICC, Human)
• AD Kolb, AB Shupp, D Mukhopadhy, FC Marini, KM Bussard Osteoblasts are "educated" by crosstalk with metastatic breast cancer cells in the bone tumor microenvironment Breast Cancer Res., 2019-02-27;21(1):31. 2019-02-27 [PMID: 30813947] (ICC, IHC-P, Human)
• A Kapelouzou, C Kontogiann, DI Tsilimigra, G Georgiopou, L Kaklamanis, L Tsourelis, DV Cokkinos Differential expression patterns of Toll Like Receptors and Interleukin-37 between calcific aortic and mitral valve cusps in humans Cytokine, 2019-02-01;116(0):150-160. 2019-02-01 [PMID: 30716659] (IHC, Human)
• X Gao, A Lu, Y Tang, J Schneppend, AB Liebowitz, AC Scibetta, ER Morris, H Cheng, C Huard, S Amra, B Wang, MA Hall, WR Lowe, J Huard Influences of donor and host age on human muscle-derived stem cell-mediated bone regeneration Stem Cell Res Ther, 2018-11-21;9(1):316. 2018-11-21 [PMID: 30463597] (IHC-Fr, Human)
• Y Zhu, Y Wu, J Cheng, Q Wang, Z Li, Y Wang, D Wang, H Wang, W Zhang, J Ye, H Jiang, L Wang Pharmacological activation of TAZ enhances osteogenic differentiation and bone formation of adipose-derived stem cells Stem Cell Res Ther, 2018-03-07;9(1):53. 2018-03-07 [PMID: 29514703] (IHC, Human)
• MH Amer, FRAJ Rose, KM Shakesheff, LJ White A biomaterials approach to influence stem cell fate in injectable cell-based therapies Stem Cell Res Ther, 2018-02-21;9(1):39. 2018-02-21 [PMID: 29467014] (ICC, Human)
• C Arianna, C Eliana, A Flavio, R Marco, D Giacomo, S Manuel, B Elena, G Alessandra Rapid Rapamycin-Only Induced Osteogenic Differentiation of Blood-Derived Stem Cells and Their Adhesion to Natural and Artificial Scaffolds Stem Cells Int, 2017-07-26;2017(0):2976541. 2017-07-26 [PMID: 28814956] (ICC, Human)
• G Lisignoli, E Lambertini, C Manferdini, E Gabusi, L Penolazzi, F Paolella, M Angelozzi, V Casagranda, R Piva Collagen type XV and the 'osteogenic status' J. Cell. Mol. Med, 2017-03-22;0(0):. 2017-03-22 [PMID: 28332281] (Flow Cytometry, Human)
• K Tatebayash, Y Tanaka, A Nakano-Doi, R Sakuma, S Kamachi, M Shirakawa, K Uchida, H Kageyama, T Takagi, S Yoshimura, T Matsuyama, T Nakagomi Identification of multipotent stem cells in human brain tissue following stroke Stem Cells Dev, 2017-04-19;0(0):. 2017-04-19 [PMID: 28323540] (ICC, Human)
• YR Lou, TC Toh, YH Tee, H Yu 25-Hydroxyvitamin D3 induces osteogenic differentiation of human mesenchymal stem cells Sci Rep, 2017-02-17;7(0):42816. 2017-02-17 [PMID: 28211493] (ICC, Human)
• Transcriptome sequencing wide functional analysis of human mesenchymal stem cells in response to TLR4 ligand Sci Rep, 2016-07-22;6(0):30311. 2016-07-22 [PMID: 27444640] (IHC, Human)
• Immobilized WNT Proteins Act as a Stem Cell Niche for Tissue Engineering Stem Cell Reports, 2016-07-12;7(1):126-37. 2016-07-12 [PMID: 27411105] (IHC, Human)
• N Nasiri, A Ceramidas, S Mukherjee, A Panneersel, DR Nisbet, A Tricoli Ultra-Porous Nanoparticle Networks: A Biomimetic Coating Morphology for Enhanced Cellular Response and Infiltration Sci Rep, 2016-04-14;6(0):24305. 2016-04-14 [PMID: 27076035] (IHC-Fr, Mouse)
• Zhu W, Zhang Q, Zhang Y, Cen L, Wang J PDL regeneration via cell homing in delayed replantation of avulsed teeth. J Transl Med, 2015-11-14;13(0):357. 2015-11-14 [PMID: 26572489] (IHC-P, Canine)
• Pereira R, Delany A, Khouzam N, Bowen R, Freymiller E, Salusky I, Wesseling-Perry K Primary osteoblast-like cells from patients with end-stage kidney disease reflect gene expression, proliferation, and mineralization characteristics ex vivo. Kidney Int, 2014-10-29;87(3):593-601. 2014-10-29 [PMID: 25354236] (IHC, Human)
• Marfia G, Navone S, Di Vito C, Tabano S, Giammattei L, Di Cristofori A, Gualtierotti R, Tremolada C, Zavanone M, Caroli M, Torchia F, Miozzo M, Rampini P, Riboni L, Campanella R Gene expression profile analysis of human mesenchymal stem cells from herniated and degenerated intervertebral discs reveals different expression of osteopontin. Stem Cells Dev, 2014-10-29;24(3):320-8. 2014-10-29 [PMID: 25203751] (ICC, Human)
• Xia H, Bodempudi V, Benyumov A, Hergert P, Tank D, Herrera J, Braziunas J, Larsson O, Parker M, Rossi D, Smith K, Peterson M, Limper A, Jessurun J, Connett J, Ingbar D, Phan S, Bitterman P, Henke C Identification of a cell-of-origin for fibroblasts comprising the fibrotic reticulum in idiopathic pulmonary fibrosis. Am J Pathol, 2014-03-13;184(5):1369-83. 2014-03-13 [PMID: 24631025] (IHC, Human)
• Govindarajan P, Bocker W, El Khassawna T, Kampschulte M, Schlewitz G, Huerter B, Sommer U, Durselen L, Ignatius A, Bauer N, Szalay G, Wenisch S, Lips K, Schnettler R, Langheinrich A, Heiss C Bone matrix, cellularity, and structural changes in a rat model with high-turnover osteoporosis induced by combined ovariectomy and a multiple-deficient diet. Am J Pathol, 2013-12-31;184(3):765-77. 2013-12-31 [PMID: 24384131] (IHC, Rat)
• Reinhardt P, Glatza M, Hemmer K, Tsytsyura Y, Thiel C, Hoing S, Moritz S, Parga J, Wagner L, Bruder J, Wu G, Schmid B, Ropke A, Klingauf J, Schwamborn J, Gasser T, Scholer H, Sterneckert J Derivation and expansion using only small molecules of human neural progenitors for neurodegenerative disease modeling. PLoS ONE, 2013-03-22;8(3):e59252. 2013-03-22 [PMID: 23533608] (ICC, Human)
• Poundarik , Atharva, Diab , Tamim, Sroga , Grazyna, Ural , Ani, Boskey , Adele L, Gundberg , Caren M, Vashishth , Deepak Dilatational band formation in bone. Proc Natl Acad Sci U S A, 2012-11-05;109(47):19178-83. 2012-11-05 [PMID: 23129653] (IHC, Human)
• Asumda FZ, Chase PB Age-related changes in rat bone-marrow mesenchymal stem cell plasticity. BMC Cell Biol., 2011-10-12;12(0):44. 2011-10-12 [PMID: 21992089] (ICC, Rat)
• Curran JM, Chen R, Hunt JA The guidance of human mesenchymal stem cell differentiation in vitro by controlled modifications to the cell substrate. Biomaterials, 2006-06-02;27(27):4783-93. 2006-06-02 [PMID: 16735063] (ICC, Human)
• Krout A, Wen HB, Hippensteel E, Li P A hybrid coating of biomimetic apatite and osteocalcin. J Biomed Mater Res A, 2005-06-15;73(4):377-87. 2005-06-15 [PMID: 15957205] (IHC, Rat)

Reviews for Osteocalcin Antibody (MAB1419) (3)

Average Rating: 4.3

(Based on 3 reviews)

We have 3 reviews tested in 2 species: Human, Rat.

reviewed by: Verified Customer ICC Human 02/09/2022

Summary

• Application: Immunocytochemistry
• Sample Tested: Mesenchymal stem cells
• Species: Human
• Lot: 190125

Comments

• Comments: The antibody was used at 10 ug/ml for 3 hours at room temperature.

reviewed by: Verified Customer ICC Rat 02/10/2015

Summary

• Application: Immunocytochemistry
• Sample Tested: See PMID 22364878
• Species: Rat

reviewed by: Verified Customer Flow Human 02/10/2015

Summary

• Application: Flow Cytometry
• Sample Tested: See PMID 22034088
• Species: Human

Bioinformatics

• Gene Symbol: BGLAP
• Uniprot:
  • P02818()