Osteocalcin Antibody (190125)

Images

 
Osteocalcin was detected in immersion fixed paraffin-embedded sections of human osteosarcoma using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 25 µg/mL overnight at 4 °C. Tissue was ...read more
Osteocalcin was detected in immersion fixed MG‑63 human osteosarcoma cell line using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 10 µg/mL for 3 hours at room temperature. Cells were ...read more
Osteocalcin was detected in immersion fixed rat osteocytes differentiated from mesenchymal stem cells using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 10 µg/mL for 3 hours at room ...read more
Saos‑2 human osteosarcoma cell line was stained with Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419, filled histogram) or isotype control antibody (Catalog # MAB002, open histogram), followed ...read more
Human osteoblasts were stained with Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419, filled histogram) or isotype control antibody (Catalog # MAB002, open histogram), followed by ...read more
Osteocalcin was detected in human mesenchymal stem cells differentiated into osteocytes using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 10 µg/mL for 3 hours at room temperature. Cells ...read more
Osteocalcin was detected in immersion fixed paraffin-embedded sections of human cartilage using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 8 µg/mL overnight at 4 °C. Tissue was stained ...read more

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications IHC, CyTOF-ready, Flow, ICC/IF
Clone
190125
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated
Concentration
LYOPH

Osteocalcin Antibody (190125) Summary

Immunogen
Human Osteocalcin synthetic peptide
YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
Accession # P02818
Specificity
Detects human Osteocalcin in direct ELISAs.
Source
N/A
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
BGLAP
Purity
Protein A or G purified from hybridoma culture supernatant
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 8-25 ug/mL
  • CyTOF-ready
  • Immunocytochemistry 8-25 ug/mL
  • Intracellular Staining by Flow Cytometry 2.5 ug/10^6 cells
Reviewed Applications
Read 2 Reviews rated 4
using
MAB1419 in the following applications:

Publications
Read Publications using
MAB1419 in the following applications:

Packaging, Storage & Formulations

Storage
Use a manual defrost freezer and avoid repeated freeze-thaw cycles.
  • 12 months from date of receipt, -20 to -70 °C as supplied.
  • 1 month, 2 to 8 °C under sterile conditions after reconstitution.
  • 6 months, -20 to -70 °C under sterile conditions after reconstitution.
Buffer
Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied as a 0.2 µm filtered solution in PBS.
Preservative
No Preservative
Concentration
LYOPH
Purity
Protein A or G purified from hybridoma culture supernatant
Reconstitution Instructions
Reconstitute at 0.5 mg/mL in sterile PBS.

Notes

This product is produced by and ships from R&D Systems, Inc., a Bio-Techne brand.

Alternate Names for Osteocalcin Antibody (190125)

  • BGLAP
  • BGP
  • bone gamma-carboxyglutamate (gla) protein (osteocalcin)
  • bone gamma-carboxyglutamate (gla) protein
  • Bone Gla protein
  • Gamma-carboxyglutamic acid-containing protein
  • OC
  • OCN
  • Osteocalcin

Background

Osteocalcin, also known as Bone gamma -Carboxyglutamic Acid Protein, is a secreted protein whose expression is restricted to cells of the osteoblast lineage (1). It has been frequently used as a marker for osteoblast lineage cells.
  1. Lian, J.B. et al. (1999) Vitamin. Horm. 55:443.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-35216
Species: Hu
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB300-164
Species: Hu, Po, Ca, Rt(-)
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-3638
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP2-32263
Species: Hu
Applications: WB, IHC, IP
NBP2-42378
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89134
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86713
Species: Hu
Applications: IHC, IHC-P
NBP1-77461
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56505
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NBP1-89796
Species: Hu, Mu
Applications: IHC, IHC-P
NBP1-47863
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, Flow, ICC/IF

Publications for Osteocalcin Antibody (MAB1419)(18)

We have publications tested in 4 confirmed species: Human, Mouse, Rat, Canine.

We have publications tested in 9 applications: Flow, ICC, IF, IHC, IHC - Not specified, IHC - PFA fixed, IHC - Paraffin embedded, IHC Fresh, IHC Not Specified.


Filter By Application
Flow
(1)
ICC
(7)
IF
(1)
IHC
(3)
IHC - Not specified
(1)
IHC - PFA fixed
(2)
IHC - Paraffin embedded
(1)
IHC Fresh
(1)
IHC Not Specified
(1)
All Applications
Filter By Species
Human
(13)
Mouse
(1)
Rat
(3)
Canine
(1)
All Species
Showing Publications 1 - 10 of 18. Show All 18 Publications.
Publications using MAB1419 Applications Species
Y Zhu, Y Wu, J Cheng, Q Wang, Z Li, Y Wang, D Wang, H Wang, W Zhang, J Ye, H Jiang, L Wang Pharmacological activation of TAZ enhances osteogenic differentiation and bone formation of adipose-derived stem cells Stem Cell Res Ther, 2018;9(1):53. 2018 [PMID: 29514703] (IHC,, Human) IHC Human
MH Amer, FRAJ Rose, KM Shakesheff, LJ White A biomaterials approach to influence stem cell fate in injectable cell-based therapies Stem Cell Res Ther, 2018;9(1):39. 2018 [PMID: 29467014] (ICC,, Human) ICC Human
C Arianna, C Eliana, A Flavio, R Marco, D Giacomo, S Manuel, B Elena, G Alessandra Rapid Rapamycin-Only Induced Osteogenic Differentiation of Blood-Derived Stem Cells and Their Adhesion to Natural and Artificial Scaffolds Stem Cells Int, 2017;2017(0):2976541. 2017 [PMID: 28814956] (ICC,, Human) ICC Human
G Lisignoli, E Lambertini, C Manferdini, E Gabusi, L Penolazzi, F Paolella, M Angelozzi, V Casagranda, R Piva Collagen type XV and the 'osteogenic status' J. Cell. Mol. Med, 2017;0(0):. 2017 [PMID: 28332281] (Flow,, Human) Flow Human
K Tatebayash, Y Tanaka, A Nakano-Doi, R Sakuma, S Kamachi, M Shirakawa, K Uchida, H Kageyama, T Takagi, S Yoshimura, T Matsuyama, T Nakagomi Identification of multipotent stem cells in human brain tissue following stroke Stem Cells Dev, 2017;0(0):. 2017 [PMID: 28323540] (ICC,, Human) ICC Human
YR Lou, TC Toh, YH Tee, H Yu 25-Hydroxyvitamin D3 induces osteogenic differentiation of human mesenchymal stem cells Sci Rep, 2017;7(0):42816. 2017 [PMID: 28211493] (ICC,, Human) ICC Human
Transcriptome sequencing wide functional analysis of human mesenchymal stem cells in response to TLR4 ligand Sci Rep, 2016;6(0):30311. 2016 [PMID: 27444640] (IHC - PFA fixed,, Human) IHC - PFA fixed Human
Immobilized WNT Proteins Act as a Stem Cell Niche for Tissue Engineering Stem Cell Reports, 2016;7(1):126-37. 2016 [PMID: 27411105] (IHC - PFA fixed,, Human) IHC - PFA fixed Human
N Nasiri, A Ceramidas, S Mukherjee, A Panneersel, DR Nisbet, A Tricoli Ultra-Porous Nanoparticle Networks: A Biomimetic Coating Morphology for Enhanced Cellular Response and Infiltration Sci Rep, 2016;6(0):24305. 2016 [PMID: 27076035] (IHC Fresh,, Mouse) IHC Fresh Mouse
Zhu W, Zhang Q, Zhang Y, Cen L, Wang J PDL regeneration via cell homing in delayed replantation of avulsed teeth. J Transl Med, 2015;13(0):357. 2015 [PMID: 26572489] (IHC - Paraffin embedded,, Canine) IHC - Paraffin embedded Canine
Show All 18 Publications.

Reviews for Osteocalcin Antibody (MAB1419) (2) 42

Average Rating: 4
(Based on 2 reviews)
We have 2 reviews tested in 2 species: Human, Rat.

Reviews using MAB1419:
Filter by Applications
ICC
(1)
Flow
(1)
All Applications
Filter by Species
Human
(1)
Rat
(1)
All Species
Images Ratings Applications Species Date Details
 
reviewed by:
Anonymous
ICC Rat 02/10/2015
View

Summary

ApplicationImmunocytochemistry
Sample TestedSee PMID 22364878
SpeciesRat

Blocking

Blocking DetailsSee PMID 22364878

Details

Detection NotesSee PMID 22364878

Comments

CommentsIndependent review from antibodyresource.com
 
reviewed by:
Anonymous
Flow Human 02/10/2015
View

Summary

ApplicationFlow Cytometry
Sample TestedSee PMID 22034088
SpeciesHuman

Blocking

Blocking DetailsSee PMID 22034088

Details

Detection NotesSee PMID 22034088

Comments

CommentsIndependent review from antibodyresource.com

FAQs for Osteocalcin Antibody (MAB1419) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Osteocalcin Products

Bioinformatics Tool for Osteocalcin Antibody (MAB1419)

Discover related pathways, diseases and genes to Osteocalcin Antibody (MAB1419). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Osteocalcin Antibody (MAB1419)

Discover more about diseases related to Osteocalcin Antibody (MAB1419).
 

Pathways for Osteocalcin Antibody (MAB1419)

View related products by pathway.

PTMs for Osteocalcin Antibody (MAB1419)

Learn more about PTMs related to Osteocalcin Antibody (MAB1419).

Blogs on Osteocalcin

There are no specific blogs for Osteocalcin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
2
3
0
2
0
1
0

 
Anonymous
02/10/2015
Application: ICC
Species: Rat

 
Anonymous
02/10/2015
Application: Flow
Species: Human

Bioinformatics

Gene Symbol BGLAP
Entrez
Uniprot