Osteocalcin Antibody (190125)

Images

 
Saos‑2 human osteosarcoma cell line was stained with Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419, filled histogram) or isotype control antibody (Catalog # MAB002, open histogram), followed ...read more
Human osteoblasts were stained with Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419, filled histogram) or isotype control antibody (Catalog # MAB002, open histogram), followed by ...read more
Osteocalcin was detected in human mesenchymal stem cells differentiated into osteocytes using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 10 µg/mL for 3 hours at room temperature. Cells ...read more
Osteocalcin was detected in immersion fixed paraffin-embedded sections of human cartilage using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 8 µg/mL overnight at 4 °C. Tissue was stained ...read more
Osteocalcin was detected in immersion fixed paraffin-embedded sections of human osteosarcoma using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 25 µg/mL overnight at 4 °C. Tissue was ...read more
Osteocalcin was detected in immersion fixed MG‑63 human osteosarcoma cell line using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 10 µg/mL for 3 hours at room temperature. Cells were ...read more
Osteocalcin was detected in immersion fixed rat osteocytes differentiated from mesenchymal stem cells using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 10 µg/mL for 3 hours at room ...read more

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications IHC, CyTOF-ready, Flow, ICC/IF
Clone
190125
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated
Concentration
LYOPH

Order Details

Osteocalcin Antibody (190125) Summary

Immunogen
Human Osteocalcin synthetic peptide
YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
Accession # P02818
Specificity
Detects human Osteocalcin in direct ELISAs.
Source
N/A
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
BGLAP
Purity
Protein A or G purified from hybridoma culture supernatant
Purity Statement
Protein A or G purified from hybridoma culture supernatant
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • CyTOF-ready
  • Immunocytochemistry 8-25 ug/mL
  • Immunohistochemistry 8-25 ug/mL
  • Intracellular Staining by Flow Cytometry 2.5 ug/10^6 cells
Reviewed Applications
Read 3 Reviews rated 4.3
using
MAB1419 in the following applications:

Publications
Read Publications using
MAB1419 in the following applications:

Packaging, Storage & Formulations

Storage
Use a manual defrost freezer and avoid repeated freeze-thaw cycles.
  • 12 months from date of receipt, -20 to -70 °C as supplied.
  • 1 month, 2 to 8 °C under sterile conditions after reconstitution.
  • 6 months, -20 to -70 °C under sterile conditions after reconstitution.
Buffer
Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied either lyophilized or as a 0.2 µm filtered solution in PBS.
Preservative
No Preservative
Concentration
LYOPH
Purity
Protein A or G purified from hybridoma culture supernatant
Reconstitution Instructions
Reconstitute at 0.5 mg/mL in sterile PBS.

Notes

This product is produced by and ships from R&D Systems, Inc., a Bio-Techne brand.

Alternate Names for Osteocalcin Antibody (190125)

  • BGLAP
  • BGP
  • bone gamma-carboxyglutamate (gla) protein (osteocalcin)
  • bone gamma-carboxyglutamate (gla) protein
  • Bone Gla protein
  • Gamma-carboxyglutamic acid-containing protein
  • OC
  • OCN
  • Osteocalcin

Background

Osteocalcin, also known as Bone gamma -Carboxyglutamic Acid Protein, is a secreted protein whose expression is restricted to cells of the osteoblast lineage (1). It has been frequently used as a marker for osteoblast lineage cells.
  1. Lian, J.B. et al. (1999) Vitamin. Horm. 55:443.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB7665
Species: Hu
Applications: IHC, WB
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB300-164
Species: Ca, Hu, Mu, Po, Pm, Rt(-)
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, WB
AF808
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-3638
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI, WB
DPI00
Species: Hu
Applications: ELISA
NBP2-32263
Species: Hu, Mu
Applications: IHC, IP, WB
DCC270
Species: Hu
Applications: ELISA
NBP1-89133
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89134
Species: Hu
Applications: IHC, IHC-P
H00138428-P01
Species: Hu
Applications: ELISA, AP, PA, WB
DY805
Species: Hu
Applications: ELISA
291-G1
Species: Hu
Applications: BA
355-BM/CF
Species: Hu, Mu, Rt
Applications: BA
AF4014
Species: Hu
Applications: WB
NBP1-89796
Species: Hu, Mu
Applications: IHC, IHC-P
NBP1-47863
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, Flow, ICC/IF

Publications for Osteocalcin Antibody (MAB1419)(31)

We have publications tested in 4 confirmed species: Human, Mouse, Rat, Canine.

We have publications tested in 6 applications: Flow Cytometry, ICC, ICC/IF, IHC, IHC-Fr, IHC-P.


Filter By Application
Flow Cytometry
(1)
ICC
(13)
ICC/IF
(1)
IHC
(13)
IHC-Fr
(2)
IHC-P
(1)
All Applications
Filter By Species
Human
(22)
Mouse
(2)
Rat
(6)
Canine
(1)
All Species
Showing Publications 1 - 10 of 31. Show All 31 Publications.
Publications using MAB1419 Applications Species
JP Ribeiro, RMA Domingues, PS Babo, LP Nogueira, JE Reseland, RL Reis, M Gomez-Flor, ME Gomes Highly elastic and bioactive bone biomimetic scaffolds based on platelet lysate and biomineralized cellulose nanocrystals Carbohydrate polymers, 2022;292(0):119638. 2022 [PMID: 35725198] (IHC, Human) IHC Human
B Zhang, M Xiao, X Cheng, Y Bai, H Chen, Q Yu, L Qiu Enamel Matrix Derivative Enhances the Odontoblastic Differentiation of Dental Pulp Stem Cells via Activating MAPK Signaling Pathways Stem Cells International, 2022;2022(0):2236250. 2022 [PMID: 35530415] (IHC, Mouse) IHC Mouse
NA Luchman, R Megat Abdu, SH Zainal Ari, NS Nasruddin, SF Lau, F Yazid Comparison between hydroxyapatite and polycaprolactone in inducing osteogenic differentiation and augmenting maxillary bone regeneration in rats PeerJ, 2022;10(0):e13356. 2022 [PMID: 35529494] (IHC, Rat) IHC Rat
S Martin-Igl, L Milian, M Sancho-Tel, R Salvador-C, JJ Martín de, C Carda, M Mata BMP-2 Enhances Osteogenic Differentiation of Human Adipose-Derived and Dental Pulp Stem Cells in 2D and 3D In Vitro Models Stem Cells International, 2022;2022(0):4910399. 2022 [PMID: 35283997] (ICC, Human) ICC Human
Q Heydt, C Xintaropou, A Clear, M Austin, I Pislariu, F Miraki-Mou, P Cutillas, K Korfi, M Calaminici, W Cawthorn, K Suchacki, A Nagano, JG Gribben, M Smith, JD Cavenagh, H Oakervee, A Castleton, D Taussig, B Peck, A Wilczynska, L McNaughton, D Bonnet, F Mardakheh, B Patel Adipocytes disrupt the translational programme of acute lymphoblastic leukaemia to favour tumour survival and persistence Nature Communications, 2021;12(1):5507. 2021 [PMID: 34535653] (ICC/IF, Human) ICC/IF Human
L E, R Lu, J Sun, H Li, W Xu, H Xing, X Wang, T Cheng, S Zhang, X Ma, R Zhang, H Liu Microenvironment Influences on Human Umbilical Cord Mesenchymal Stem Cell-Based Bone Regeneration Stem Cells International, 2021;2021(0):4465022. 2021 [PMID: 34447439] (ICC, Human) ICC Human
S Lv, J Xu, L Chen, H Wu, W Feng, Y Zheng, P Li, H Zhang, L Zhang, G Chi, Y Li MicroRNA-27b targets CBFB to inhibit differentiation of human bone marrow mesenchymal stem cells into hypertrophic chondrocytes Stem Cell Res Ther, 2020;11(1):392. 2020 [PMID: 32917285] (IHC, Rat) IHC Rat
C Liang, Z Liu, M Song, W Li, Z Wu, Z Wang, Q Wang, S Wang, K Yan, L Sun, T Hishida, Y Cai, JCI Belmonte, P Guillen, P Chan, Q Zhou, W Zhang, J Qu, GH Liu Stabilization of heterochromatin by CLOCK promotes stem cell rejuvenation and cartilage regeneration Cell Res., 2020;0(0):. 2020 [PMID: 32737416] (ICC, Human) ICC Human
J Chen, C Tu, X Tang, H Li, J Yan, Y Ma, H Wu, C Liu The combinatory effect of sinusoidal electromagnetic field and VEGF promotes osteogenesis and angiogenesis of mesenchymal stem cell-laden PCL/HA implants in a rat subcritical cranial defect Stem Cell Res Ther, 2019;10(1):379. 2019 [PMID: 31842985] (ICC, Rat) ICC Rat
V Miceli, M Pampalone, S Vella, AP Carreca, G Amico, PG Conaldi Comparison of Immunosuppressive and Angiogenic Properties of Human Amnion-Derived Mesenchymal Stem Cells between 2D and 3D Culture Systems Stem Cells Int, 2019;2019(0):7486279. 2019 [PMID: 30911299] (ICC, Human) ICC Human
Show All 31 Publications.

Reviews for Osteocalcin Antibody (MAB1419) (3) 4.33

Average Rating: 4.3
(Based on 3 reviews)
We have 3 reviews tested in 2 species: Human, Rat.

Reviews using MAB1419:
Filter by Applications
ICC
(2)
Flow
(1)
All Applications
Filter by Species
Human
(2)
Rat
(1)
All Species
Images Ratings Applications Species Date Details
Immunocytochemistry Osteocalcin MAB1419
Enlarge
5
reviewed by:
Michael Nowak
ICC Human 02/09/2022
View

Summary

ApplicationImmunocytochemistry
Sample TestedMesenchymal stem cells
SpeciesHuman
Lot190125

Comments

CommentsThe antibody was used at 10 ug/ml for 3 hours at room temperature.
  4
reviewed by:
cynthia morimoto
ICC Rat 02/10/2015
View

Summary

ApplicationImmunocytochemistry
Sample TestedSee PMID 22364878
SpeciesRat
  4
reviewed by:
cynthia morimoto
Flow Human 02/10/2015
View

Summary

ApplicationFlow Cytometry
Sample TestedSee PMID 22034088
SpeciesHuman

FAQs for Osteocalcin Antibody (MAB1419) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Osteocalcin Products

Bioinformatics Tool for Osteocalcin Antibody (MAB1419)

Discover related pathways, diseases and genes to Osteocalcin Antibody (MAB1419). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Osteocalcin Antibody (MAB1419)

Discover more about diseases related to Osteocalcin Antibody (MAB1419).
 

Pathways for Osteocalcin Antibody (MAB1419)

View related products by pathway.

PTMs for Osteocalcin Antibody (MAB1419)

Learn more about PTMs related to Osteocalcin Antibody (MAB1419).

Blogs on Osteocalcin

There are no specific blogs for Osteocalcin, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4.3
5
1
4
2
3
0
2
0
1
0

Michael Nowak
02/09/2022
Application: ICC
Species: Human

 
cynthia morimoto
02/10/2015
Application: ICC
Species: Rat

 
cynthia morimoto
02/10/2015
Application: Flow
Species: Human

Bioinformatics

Gene Symbol BGLAP
Uniprot