We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Osteocalcin Antibody (190125)

Images

 
NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips." > Osteocalcin was detected in immersion fixed MG-63 human osteosarcoma cell line using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # <a class=NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips." title="Osteocalcin was detected in immersion fixed MG-63 human osteosarcoma cell line using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips." />
Osteocalcin was detected in immersion fixed MG-63 human osteosarcoma cell line using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 10 µg/mL for 3 hours at room temperature. Cells were ...read more
NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips." > NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips." title="Osteocalcin was detected in human mesenchymal stem cells differentiated into osteocytes using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips." />
Osteocalcin was detected in human mesenchymal stem cells differentiated into osteocytes using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 10 µg/mL for 3 hours at room temperature. Cells ...read more
NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips." > NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips." title="Osteocalcin was detected in immersion fixed rat osteocytes differentiated from mesenchymal stem cells using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips." />
Osteocalcin was detected in immersion fixed rat osteocytes differentiated from mesenchymal stem cells using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 10 µg/mL for 3 hours at room ...read more
CTS002) and counterstained with hematoxylin (blue). Specific labeling was localized to the cytoplasm of chondrocytes. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections." > CTS002) and counterstained with hematoxylin (blue). Specific labeling was localized to the cytoplasm of chondrocytes. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections." title="Osteocalcin was detected in immersion fixed paraffin-embedded sections of human cartilage using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 8 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Specific labeling was localized to the cytoplasm of chondrocytes. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections." />
Osteocalcin was detected in immersion fixed paraffin-embedded sections of human cartilage using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 8 µg/mL overnight at 4 °C. Tissue was stained ...read more
CTS002) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections." > CTS002) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections." title="Osteocalcin was detected in immersion fixed paraffin-embedded sections of human osteosarcoma using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 25 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections." />
Osteocalcin was detected in immersion fixed paraffin-embedded sections of human osteosarcoma using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 25 µg/mL overnight at 4 °C. Tissue was ...read more
MAB002, open histogram), followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin." > MAB002, open histogram), followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin." title="Saos-2 human osteosarcoma cell line was stained with Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419, filled histogram) or isotype control antibody (Catalog # MAB002, open histogram), followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin." />
Saos-2 human osteosarcoma cell line was stained with Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419, filled histogram) or isotype control antibody (Catalog # ...read more
MAB002, open histogram), followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin." > MAB002, open histogram), followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin." title="Human osteoblasts were stained with Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419, filled histogram) or isotype control antibody (Catalog # MAB002, open histogram), followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin." />
Human osteoblasts were stained with Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419, filled histogram) or isotype control antibody (Catalog # ...read more
Exposure of TAZ activator TM-25659 promotes osteogenic differentiation of ADSCs in vitro. a Cell viability was determined after ADSCs were cultured with diverse concentrations of TM-25659 (0–50 μM) at 24 h and 48 h, ...read more
Nano-fiber plugs induce osteogenesis of human MSCs.Healthy donor-derived MSCs were seeded onto plastic plates (A-C) or injected into the nano-fiber plugs (D-I), and then cultured in MSCGM for 1 day (D), 7 days (E, G), ...read more
Nano-fiber plugs induce osteogenesis of human MSCs.Healthy donor-derived MSCs were seeded onto plastic plates (A-C) or injected into the nano-fiber plugs (D-I), and then cultured in MSCGM for 1 day (D), 7 days (E, G), ...read more
Nano-fiber plugs induce osteogenesis of human MSCs.Healthy donor-derived MSCs were seeded onto plastic plates (A-C) or injected into the nano-fiber plugs (D-I), and then cultured in MSCGM for 1 day (D), 7 days (E, G), ...read more
Enforced TAZ overexpression enhances osteogenic differentiation of ADSCs in vitro. a Transcriptional coactivator with PDZ-binding motif (TAZ) overexpression (OP) in ADSCs infected with lentiviral particles containing ...read more
Genetic Strategies: TAZ knockdown impairs osteogenic differentiation of ADSCs in vitro. a Transcriptional coactivator with PDZ-binding motif (TAZ) knockdown (KD) in ADSCs infected with shRNA lentiviral particles ...read more
TAZ is upregulated during osteogenesis while it is downregulated during adipogenesis in human ADSCs. a Osteogenic differentiation of ADSCs was induced in vitro and monitored by Alizarin Red and von Kossa staining at the ...read more
In vitro differentiation capacity of young and old BM-MSCs: (A) Representative micrographs from each experimental group showing morphological change after 21 days of differentiation. (B) Results of adipogenic, ...read more
Biological Strategies: TM-25659 promotes in vivo bone formation of ADSCs. a Schematic description of experimental procedure for in vivo transplantation. Adipose-derived stem cells (ASCs) were initially treated ...read more
Nano-fiber plugs induce osteogenesis of human MSCs.Healthy donor-derived MSCs were seeded onto plastic plates (A-C) or injected into the nano-fiber plugs (D-I), and then cultured in MSCGM for 1 day (D), 7 days (E, G), ...read more
Nano-fiber plugs induce osteogenesis of human MSCs.Healthy donor-derived MSCs were seeded onto plastic plates (A-C) or injected into the nano-fiber plugs (D-I), and then cultured in MSCGM for 1 day (D), 7 days (E, G), ...read more
Nano-fiber plugs induce osteogenesis of human MSCs.Healthy donor-derived MSCs were seeded onto plastic plates (A-C) or injected into the nano-fiber plugs (D-I), and then cultured in MSCGM for 1 day (D), 7 days (E, G), ...read more
Biological Strategies: TM-25659 delivery by oral gavage promotes in vivo bone formation of ADSCs. a Schematic description of the experimental procedure for in vivo transplantation. Adipose-derived stem cells ...read more
Msx1+ SSCs subset is a source of osteogenesis and closely correlates with endochondral ossification.a Schematic of the assessment of Msx1+ SSCs subset in differentiation hierarchy by Prx1-lineage tracing mice. b, c HE ...read more
3D printed hydrogel scaffold with NSs enhances in vitro expansion and osteogenic potential of MSCs.a Schematic diagram of NSs-loaded 3D printing gel scaffold by DLP technology. b Bright field image of MSCs distribution ...read more

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications IHC, CyTOF-ready, Flow, ICC/IF
Clone
190125
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated
Concentration
LYOPH

Order Details

Osteocalcin Antibody (190125) Summary

Immunogen
Human Osteocalcin synthetic peptide
YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
Accession # P02818
Specificity
Detects human Osteocalcin in direct ELISAs.
Source
N/A
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
BGLAP
Purity Statement
Protein A or G purified from hybridoma culture supernatant
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • CyTOF-ready
  • Immunocytochemistry 8-25 ug/mL
  • Immunohistochemistry 8-25 ug/mL
  • Intracellular Staining by Flow Cytometry 2.5 ug/10^6 cells
Reviewed Applications
Read 3 Reviews rated 4.3
using
MAB1419 in the following applications:

Publications
Read Publications using
MAB1419 in the following applications:

Packaging, Storage & Formulations

Storage
Use a manual defrost freezer and avoid repeated freeze-thaw cycles.
  • 12 months from date of receipt, -20 to -70 °C as supplied.
  • 1 month, 2 to 8 °C under sterile conditions after reconstitution.
  • 6 months, -20 to -70 °C under sterile conditions after reconstitution.
Buffer
Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied either lyophilized or as a 0.2 µm filtered solution in PBS.
Preservative
No Preservative
Concentration
LYOPH
Reconstitution Instructions
Reconstitute at 0.5 mg/mL in sterile PBS.

Notes

This product is produced by and ships from R&D Systems, Inc., a Bio-Techne brand.

Alternate Names for Osteocalcin Antibody (190125)

  • BGLAP
  • BGP
  • bone gamma-carboxyglutamate (gla) protein (osteocalcin)
  • bone gamma-carboxyglutamate (gla) protein
  • Bone Gla protein
  • Gamma-carboxyglutamic acid-containing protein
  • OC
  • OCN
  • Osteocalcin

Background

Osteocalcin, also known as Bone gamma -Carboxyglutamic Acid Protein, is a secreted protein whose expression is restricted to cells of the osteoblast lineage (1). It has been frequently used as a marker for osteoblast lineage cells.
  1. Lian, J.B. et al. (1999) Vitamin. Horm. 55:443.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-65676
Species: Hu
Applications: ELISA, IHC, IHC-Fr,  IHC-P
NBP1-89953
Species: Hu
Applications: IHC,  IHC-P
NB300-164
Species: Ca, Hu, Mu, Po, Pm, Rt(-)
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KO, PLA, WB
AF808
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
NBP2-92749
Species: Hu, Mu
Applications: ELISA, WB
NB110-3638
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, RI, WB
DPI00
Species: Hu
Applications: ELISA
NBP3-15742
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
DCC270
Species: Hu
Applications: ELISA
NBP1-89133
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-25358
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-86713
Species: Hu
Applications: IHC,  IHC-P
DY805
Species: Hu
Applications: ELISA
291-G1
Species: Hu
Applications: BA
355-BM
Species: Hu, Mu, Rt
Applications: BA
4014-SP
Species: Hu
Applications: BA
NBP2-82180
Species: Hu
Applications: ELISA
NBP1-47863
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, Flow, ICC/IF

Publications for Osteocalcin Antibody (MAB1419)(59)

We have publications tested in 5 confirmed species: Human, Mouse, Rat, Canine, Equine.

We have publications tested in 8 applications: Flow Cytometry, ICC, ICC/IF, IHC, IHC-Fr, IHC-P, Immunohistochemistry, Western Blot.


Filter By Application
Flow Cytometry
(2)
ICC
(16)
ICC/IF
(1)
IHC
(16)
IHC-Fr
(2)
IHC-P
(2)
Immunohistochemistry
(3)
Western Blot
(1)
All Applications
Filter By Species
Human
(30)
Mouse
(3)
Rat
(8)
Canine
(1)
Equine
(1)
All Species
Showing Publications 1 - 10 of 59. Show All 59 Publications.
Publications using MAB1419 Applications Species
Yu, Y;Lee, S;Bock, M;An, SB;Shin, HE;Rim, JS;Kwon, JO;Park, KS;Han, I; Promotion of Bone Formation in a Rat Osteoporotic Vertebral Body Defect Model via Suppression of Osteoclastogenesis by Ectopic Embryonic Calvaria Derived Mesenchymal Stem Cells International journal of molecular sciences 2024-07-26 [PMID: 39125746] (Immunohistochemistry, Rat) Immunohistochemistry Rat
Cárdenas-Aguazaco, W;Camacho, B;Gómez-Pachón, EY;Lara-Bertrand, AL;Silva-Cote, I; Electrospun Scaffolds of Polylactic Acid, Collagen, and Amorphous Calcium Phosphate for Bone Repair Pharmaceutics 2023-10-25 [PMID: 38004509] (IHC, Human) IHC Human
Shi Yin, Sihan Lin, Jingyi Xu, Guangzheng Yang, Hongyan Chen, Xinquan Jiang Dominoes with interlocking consequences triggered by zinc: involvement of microelement-stimulated MSC-derived exosomes in senile osteogenesis and osteoclast dialogue J Nanobiotechnology 9/23/2023 [PMID: 37741978]
Umrath, F;Schmitt, LF;Kliesch, SM;Schille, C;Geis-Gerstorfer, J;Gurewitsch, E;Bahrini, K;Peters, F;Reinert, S;Alexander, D; Mechanical and Functional Improvement of ?-TCP Scaffolds for Use in Bone Tissue Engineering Journal of functional biomaterials 2023-08-16 [PMID: 37623671] (Human) Human
Honorine Dushime, Stéphanie G. Moreno, Christine Linard, Annie Adrait, Yohann Couté, Juliette Peltzer et al. Fetal Muse-based therapy prevents lethal radio-induced gastrointestinal syndrome by intestinal regeneration Stem Cell Research & Therapy 8/11/2023 [PMID: 37568164]
Gomez-Sequeda, N;Mendivil-Perez, M;Jimenez-Del-Rio, M;Lopera, F;Velez-Pardo, C; Cholinergic-like neurons and cerebral spheroids bearing the PSEN1 p.Ile416Thr variant mirror Alzheimer's disease neuropathology Scientific reports 2023-08-08 [PMID: 37553376] (ICC, Human) ICC Human
Li Jinteng, Xu Peitao, Yu Wenhui, Ye Guiwen, Ye Feng, Xu Xiaojun et al. BMAL1-TTK-H2Bub1 loop deficiency contributes to impaired BM-MSC-mediated bone formation in senile osteoporosis Molecular Therapy - Nucleic Acids 3/14/2023 [PMID: 36910712]
SK Grissom, SA Semevolos, K Duesterdie Role of cartilage and bone matrix regulation in early equine osteochondrosis Bone Reports, 2023-01-05;18(0):101653. 2023-01-05 [PMID: 36632355] (IHC, Equine) IHC Equine
Fiona Verisqa, Jae-Ryung Cha, Linh Nguyen, Hae-Won Kim, Jonathan C. Knowles Digital Light Processing 3D Printing of Gyroid Scaffold with Isosorbide-Based Photopolymer for Bone Tissue Engineering Biomolecules 11/15/2022 [PMID: 36421706]
NT Chan, MS Lee, Y Wang, J Galipeau, WJ Li, W Xu CTR9 drives osteochondral lineage differentiation of human mesenchymal stem cells via epigenetic regulation of BMP-2 signaling Science Advances, 2022-11-16;8(46):eadc9222. 2022-11-16 [PMID: 36383652] (ICC, Human) ICC Human
Show All 59 Publications.

Reviews for Osteocalcin Antibody (MAB1419) (3) 4.33

Average Rating: 4.3
(Based on 3 reviews)
We have 3 reviews tested in 2 species: Human, Rat.

Reviews using MAB1419:
Filter by Applications
ICC
(2)
Flow
(1)
All Applications
Filter by Species
Human
(2)
Rat
(1)
All Species
Images Ratings Applications Species Date Details
Immunocytochemistry Osteocalcin MAB1419
Enlarge
5
reviewed by:
Verified Customer
ICC Human 02/09/2022
View

Summary

ApplicationImmunocytochemistry
Sample TestedMesenchymal stem cells
SpeciesHuman
Lot190125

Comments

CommentsThe antibody was used at 10 ug/ml for 3 hours at room temperature.
  4
reviewed by:
Verified Customer
ICC Rat 02/10/2015
View

Summary

ApplicationImmunocytochemistry
Sample TestedSee PMID 22364878
SpeciesRat
  4
reviewed by:
Verified Customer
Flow Human 02/10/2015
View

Summary

ApplicationFlow Cytometry
Sample TestedSee PMID 22034088
SpeciesHuman

FAQs for Osteocalcin Antibody (MAB1419) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4.3
5
1
4
2
3
0
2
0
1
0

Verified Customer
02/09/2022
Application: ICC
Species: Human

 
Verified Customer
02/10/2015
Application: ICC
Species: Rat

 
Verified Customer
02/10/2015
Application: Flow
Species: Human

Bioinformatics

Gene Symbol BGLAP
Uniprot