Collagen I alpha 1 Antibody

Immunohistochemistry-Paraffin: Collagen I alpha 1 Antibody [NBP1-82489] - Staining of human prostate shows weak cytoplasmic positivity in smooth muscle cells.

Immunohistochemistry-Paraffin: Collagen I alpha 1 Antibody [NBP1-82489] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: Collagen I alpha 1 Antibody [NBP1-82489] - Staining of human endometrium shows moderate cytoplasmic positivity in stromal cells.

Immunohistochemistry-Paraffin: Collagen I alpha 1 Antibody [NBP1-82489] - Staining of human tonsil shows moderate cytoplasmic positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: Collagen I alpha 1 Antibody [NBP1-82489] - Staining of human placenta shows strong cytoplasmic positivity in endothelial cells.

Immunohistochemistry-Paraffin: Collagen I alpha 1 Antibody [NBP1-82489] - Staining of human endometrium shows strong extracellular space positivity in the stroma.

Immunohistochemistry-Paraffin: Collagen I alpha 1 Antibody [NBP1-82489] - Staining of human placenta shows moderate staining in extracellular space in endothelial lumina.

• Reactivity: Hu, Mu, Rt
• Applications: IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Collagen I alpha 1 Antibody Summary

• Immunogen: This Collagen I alpha 1 antibody was developed against Recombinant Protein corresponding to amino acids: NLDAIKVFCNMETGETCVYPTQPSVAQKNWYISKNPKDKRHVWFGESMTDGFQFEYGGQGSDPADVAIQLTFLRLMSTEASQNITYHCKNSVAYMDQQTGNLK
• Specificity: The specificity of this human Collagen I alpha 1 antibody was verified on a Protein Array containing the target protein plus 383 other non-specific proteins.
• Predicted Species: Mouse (90%), Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: COL1A1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Theoretical MW: 139 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  Collagen I alpha 1 Recombinant Protein Antigen (NBP1-82489PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Collagen I alpha 1 Antibody

• Alpha-1 type I collagen
• COL1A1
• Collagen 1 alpha 1
• Collagen 1
• collagen alpha 1 chain type I
• collagen alpha-1(I) chain
• Collagen I alpha 1
• collagen of skin, tendon and bone, alpha-1 chain
• Collagen Type I Alpha 1 Chain
• collagen, type I, alpha 1
• Collagen1
• Collagen-1
• EDSARTH1
• OI4
• pro-alpha-1 collagen type 1
• Type I Procollagen Alpha 1 Chain

Background

Collagen is an extracellular matrix protein that serves as a scaffold defining the shape and mechanical properties of many tissues and organs including skin, tendon, artery walls, fibrocartilage, bone and teeth. Collagens are highly conserved and are characterized by an uninterrupted "Glycine X Y" triplet repeat that is a necessary part of the triple helical structure. The extensive family of collagens is composed of several chain types, including fibril-forming interstitial collagens (types I, II, III and V) and basement membrane collagens (type IV), each type containing multiple isoforms. Collagen type I (also known as collagen alpha, COL1A1, and alpha-1 type I collagen) is the largest component of fibrillar collagen found in cartilage and connective tissues. It is synthesized by fibroblasts, osteoblasts, and odontoblasts and has a theoretical molecular weight of 138 kDa.

Type I collagen is a fibril-forming collagen found in most connective tissues and is abundant in bone, cornea, dermis and tendon tissue. Collagens are fibrous, extracellular matrix proteins with high tensile strength and are the major components of connective tissue. Several collagens play a role in cell adhesion, responsible for maintaining normal tissue architecture and function. All collagens contain a triple helix domain and frequently show lateral self-association in order to form complex connective tissues. Post-Golgi LH3 trafficking is essential for collagen homeostasis and for the development and function of multiple organs and tissues (1).

The COL1A1 gene encodes the pro-alpha1 chains of type I collagen protein, whose triple helix is comprised of two alpha1 chains and one alpha2 chain. Mutations in the encoding COL1A1 gene are associated with brittle bone disease (Osteogenesis Imperfecta), cortical hyperostosis (Caffey disease) and disorders that affect the connective tissues (Ehlers-Danlos syndrome) (2). Studies have found that HIF-1 transcription regulation of collagen prolyl hydroxylases regulates collagen deposition, promoting cancer cell alignment along collagen fibers, which enhances invasion and metastasis to lymph nodes and lung tissue by breast cancer cells (3).

References

1. Banushi, B., Forneris, F., Straatman-Iwanowska, A., Strange, A., Lyne, A. M., Rogerson, C.,... Gissen, P. (2016). Regulation of post-Golgi LH3 trafficking is essential for collagen homeostasis. Nat Commun, 7, 12111. doi:10.1038/ncomms12111

2. Lu, Y., Zhang, S., Wang, Y., Ren, X., & Han, J. (2019). Molecular mechanisms and clinical manifestations of rare genetic disorders associated with type I collagen. Intractable Rare Dis Res, 8(2), 98-107. doi:10.5582/irdr.2019.01064

3. Gilkes, D. M., Chaturvedi, P., Bajpai, S., Wong, C. C., Wei, H., Pitcairn, S.,... Semenza, G. L. (2013). Collagen prolyl hydroxylases are essential for breast cancer metastasis. Cancer Res, 73(11), 3285-3296. doi:10.1158/0008-5472.Can-12-3963

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for Collagen I alpha 1 Antibody (NBP1-82489). (Showing 1 - 5 of 5 FAQ).

1. We are looking for an anti-Collagen antibody for Flow Cytometry (FACS) analysis in Swine sample. Would you please provide some references if there is any available as well?
   • We currently have one antibody for porcine Collagen validated in flow cytometry (catalog # NBP1-94202).
2. I am looking for anti collagen 1 antibody, I see your product calls it collagen I alpha 1 is there a difference?
   • Collagen I alpha 1 is the most common protein for the collagen 1 protein. There are other subunits as well (such as collagen 1 alpha 2…etc.).
3. The predicted molecular weight says 150kDA but the band on the gel appears at 130kDA why is that?
   • Differences between the predicted and observed MW can be affected by a number of factors including PTMs, relative charges and experimental factors. These cumulative effect of these differences can be quite substantial with larger molecules such as collagen I alpha 1.
4. How long does delivery take for your collagen 1 alpha 1 antibody?
   • Our most popular collagen I alpha 1 antibody (NB600-408) is usually in stock and ships priority overnight for next business day delivery in the U.S.
5. What secondary antibody do you recommend for collagen I alpha 1 antibodies?
   • Because this collagen I alpha 1 antibody is raised in rabbit you would want to use any anti-rabbit IgG secondary antibody. NB7160 is a popular choice for use in WB.

Bioinformatics

• Gene Symbol: COL1A1