| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 145-340 of CD11b (NP_000623.2). PQEDSDIAFLIDGSGSIIPHDFRRMKEFVSTVMEQLKKSKTLFSLMQYSEEFRIHFTFKEFQNNPNPRSLVKPITQLLGRTHTATGIRKVVRELFNITNGARKNAFKILVVITDGEKFGDPLGYEDVIPEADREGVIRYVIGVGDAFRSEKSRQELNTIASKPPRDHVFQVNNFEALKTIQNQLREKIFAIEGTQT |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ITGAM |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 127 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.09% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for CD11b Antibody (NBP2-92978)Find related products by research area.
|
|
Read full blog post. |
|
Antibody treatment can generate microglia-like cells from bone marrow By Jennifer Sokolowski, MD, PhD.Microglia play important roles in the brain in both homeostatic and pathological conditions, acting to clear debris and dying cells. There is evidence to suggest that microglial dys... Read full blog post. |
|
TMEM 119 is a specific marker of microglia cells By Jennifer Sokolowski, MD, PhD.Microglia are a major immune-cell component in the brain. They ingest and degrade dead cells, debris, and foreign material and interact with other immune cells to orchestrate centra... Read full blog post. |
|
Topics in CD11b: The innate immune response Integrins are transmembrane receptors composed of alpha and beta chains, where beta-integrins are mainly expressed in leukocytes. Leukocytes are white blood cells that act in the immune system to defend our body against foreign pathogens. Integrin... Read full blog post. |
|
CD11b - More than a microglial marker The protein CD11b has been implicated in the various adhesion-related interactions of cells such as monocytes, macrophages, natural killer (NK) cells, and granulocytes. It is part of a heterodimer that consists of CD11b and CD18. It also modulates the... Read full blog post. |
|
CD11b: Marker for a New Type of B Cell that Participates in Cell-Mediated Immunity Think B lymphocytes just produce antibodies? Think again! Although, of course, B cells are vital for the humoral immune response, many studies in recent years have begun to uncover antibody-independent actions of B cells: regulating T cells and thus a... Read full blog post. |
|
Adhesion Receptor Molecule CD11b/c is the Point of Entry for many Infectious Diseases Pathogenic microorganisms utilize a variety of cell surface receptors to gain entry into host cells and to bypass the natural defense mechanisms. One of the most prominent receptors used in this fashion is the leukocyte adhesion receptor CD11b/c. This... Read full blog post. |
|
CD11b/CD18 and Neutrophil-Epithelial Interactions as Targets for Anti-Inflammatory Therapies The beta-2 integrins, a family of four cell surface transmembrane glycoproteins expressed only on leukocytes, include CD11a/CD18, CD11b/CD18, CD11c/CD18, and CD11d/CD18. They consist of a common beta subunit (CD18) and homologous alpha subunits (CD11a... Read full blog post. |
|
The CD11b Antibody: A Marker for Microglial Cells Microglia are the resident macrophages of the central nervous system, and the first line of immune defense. Pioneering antibody research in the 1990's identified the Integrin beta 2 protein (also called ITGB2, complement receptor 3, CR3, CD18, and Mac... Read full blog post. |
|
CD11b Expression, Leukocyte Adhesion and the Innate Immune System What is CD11b?CD11b is an integrin family member which pairs with CD18 to form the CR3 heterodimer. CD11b is expressed on the surface of many leukocytes including monocytes, neutrophils, natural killer cells, granulocytes and macrophages, as well as o... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ITGAM |