Novus Biologicals products are now on bio-techne.com

NDUFA2 Antibody - BSA Free

Images

 
Western Blot: NDUFA2 Antibody [NBP2-93743] - Analysis of extracts of various cell lines, using NDUFA2 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per ...read more
Immunocytochemistry/ Immunofluorescence: NDUFA2 Antibody [NBP2-93743] - Analysis of NIH/3T3 cells using NDUFA2 at dilution of 1:100. Blue: DAPI for nuclear staining.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

NDUFA2 Antibody - BSA Free Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human NDUFA2 (NP_002479.1). MAAAAASRGVGAKLGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYAFGQETNVPLNNFSADQVTRALENVL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NDUFA2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for NDUFA2 Antibody - BSA Free

  • B8
  • CD14
  • CIB8
  • CI-B8
  • complex I B8 subunit
  • Complex I-B8
  • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2 (8kD, B8)
  • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2, 8kDa
  • NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2
  • NADH-ubiquinone oxidoreductase B8 subunit
  • NADH-ubiquinone oxidoreductase subunit CI-B8

Background

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 (NDUFA2), also known as NADH-ubiquinone oxidoreductase B8 subunit, is an accessory subunit of the hydrophobic protein fraction of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). NDUFA2 may also play a role in regulating complex 1 activity and its assembly via assistance in redox processes. Mutations in the NDUFA2 gene are associated with Leigh syndrome, an early-onset progressive neurodegenerative disorder.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

M6000B
Species: Mu
Applications: ELISA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
7268-CT
Species: Hu
Applications: BA
NB100-56566
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
DY417
Species: Mu
Applications: ELISA
DY870-05
Species: Hu
Applications: ELISA
NB100-56722
Species: Ca, Hu, Mu, Rb, Rt
Applications: B/N, DB, ELISA, Flow-CS, Flow, Func, ICC/IF, IP, In vitro, WB
NB110-89474
Species: Bv, Ce, ChHa, Hu, Pm, Mu, Rt, RM
Applications: Dual ISH-IHC, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, ISH, Simple Western, Single-Cell Western, WB
6507-IL/CF
Species: Hu
Applications: BA
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
AF4117
Species: Rt
Applications: IHC, WB
AF1597
Species: Hu
Applications: Block, WB
NBP1-72042
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
MAB4841
Species: Mu
Applications: CompCytotox, CyTOF-ready, Flow, ICC, IHC, IP, Tstim
4325-FC
Species: Hu
Applications: Bind
AF114
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
1787-MD
Species: Hu
Applications: Bind
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc

Publications for NDUFA2 Antibody (NBP2-93743) (0)

There are no publications for NDUFA2 Antibody (NBP2-93743).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDUFA2 Antibody (NBP2-93743) (0)

There are no reviews for NDUFA2 Antibody (NBP2-93743). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NDUFA2 Antibody (NBP2-93743) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NDUFA2 Products

Research Areas for NDUFA2 Antibody (NBP2-93743)

Find related products by research area.

Blogs on NDUFA2

There are no specific blogs for NDUFA2, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NDUFA2 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol NDUFA2