TGF-beta 3 Antibody - BSA Free

Western Blot: TGF-beta 3 Antibody [NBP1-58287] - Sample Tissue: Human MCF7 Antibody Dilution: 1.0 ug/ml

Western Blot: TGF-beta 3 Antibody [NBP1-58287] - Titration: 0.2-1 ug/ml, Positive Control: SH-SYSY cell lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

TGF-beta 3 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to TGFB3(transforming growth factor, beta 3) The peptide sequence was selected from the middle region of TGFB3. Peptide sequence DFRQDLGWKWVHEPKGYYANFCSGPCPYLRSADTTHSTVLGLYNTLNPEA. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TGFB3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for TGF-beta 3 Antibody - BSA Free

• ARVD
• ARVD1
• FLJ16571
• LDS5
• RNHF
• TGFB3
• TGFbeta 3
• TGF-beta 3
• TGF-beta3
• TGF-beta-3
• transforming growth factor beta-3
• transforming growth factor, beta 3

Background

TGFB3 is involved in embryogenesis and cell differentiation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TGFB3
• Uniprot:
  • P10600()