Plakophilin 2 Antibody - BSA Free

Immunohistochemistry-Paraffin: Plakophilin 2 Antibody [NBP1-86078] - Analysis in human heart muscle and liver tissues using NBP1-86078 antibody. Corresponding Plakophilin 2 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Plakophilin 2 Antibody [NBP1-86078] - Staining of human heart muscle, liver, prostate and testis using Anti-Plakophilin 2 antibody NBP1-86078 (A) shows similar protein distribution across tissues to independent antibody NBP2-58748 (B).

Immunohistochemistry-Paraffin: Plakophilin 2 Antibody [NBP1-86078] - Staining of human heart muscle shows strong positivity of intercalated discs.

Immunohistochemistry-Paraffin: Plakophilin 2 Antibody [NBP1-86078] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: Plakophilin 2 Antibody [NBP1-86078] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: Plakophilin 2 Antibody [NBP1-86078] - Staining of human prostate shows low positivity in glandular cells as expected.

Staining of human cell line A-431 shows localization to nucleoplasm & cell junctions.

Analysis in human cell lines Caco-2 and SK-MEL-30 using Anti-PKP2 antibody. Corresponding PKP2 RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Plakophilin 2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Plakophilin 2 Antibody - BSA Free (NBP1-86078) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VGNGNLHRTSSVPEYVYNLHLVENDFVGGRSPVPKTYDMLKAGTTATYEGRWGRGTAQYSSQKSVEERSLRHPLRRLEISPDSSPERAHYTHSDYQYSQRSQAGHTLHHQESRRAALLVPPRY
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PKP2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Plakophilin 2 Protein (NBP1-86078PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Plakophilin 2 Antibody - BSA Free

• ARVD9
• MGC177501
• plakophilin 2
• plakophilin-2

Background

Plakophilins 1, 2, 3 and 4 (PKP1-4) influence development and participate in linking cadherins to cytoskeletal intermediate filaments. Plakophilins 1-4 contain arm-repeat (armadillo) domains and localize to nuclei and cell desmosomes (cell-cell junctions found in suprabasal layers of stratifying epithelia that undergo mechanical stress). Plakophilin 1 mediates increases in desmosomal protein content, desmosome assembly and regulation of cell migration. Plakophilin 2 is important for desmosome assembly and is an essential morphogenic factor and architectural component of the heart. Plakophilin 4 is a component of desmosomal adhesion plaques that regulates junctional plaque organization and cadherin function.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PKP2