Plakophilin 2 Antibody

Images

 
Orthogonal Strategies: Western Blot: Plakophilin 2 Antibody [NBP1-86078] - Analysis in human cell lines Caco-2 and SK-MEL-30. Corresponding RNA-seq data are presented for the same cell lines. Loading control: ...read more
Immunocytochemistry/ Immunofluorescence: Plakophilin 2 Antibody [NBP1-86078] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cell junctions. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Plakophilin 2 Antibody [NBP1-86078] - Analysis in human heart muscle and liver tissues using NBP1-86078 antibody. Corresponding Plakophilin 2 RNA-seq data are presented for the same ...read more
Immunohistochemistry-Paraffin: Plakophilin 2 Antibody [NBP1-86078] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: Plakophilin 2 Antibody [NBP1-86078] - Staining of human liver.
Immunohistochemistry-Paraffin: Plakophilin 2 Antibody [NBP1-86078] - Staining of human kidney.
Immunohistochemistry-Paraffin: Plakophilin 2 Antibody [NBP1-86078] - Staining of human testis.
Immunohistochemistry-Paraffin: Plakophilin 2 Antibody [NBP1-86078] - Staining of human heart muscle using Anti-PKP2 antibody NBP1-86078.
Immunohistochemistry-Paraffin: Plakophilin 2 Antibody [NBP1-86078] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: Plakophilin 2 Antibody [NBP1-86078] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: Plakophilin 2 Antibody [NBP1-86078] - Staining of human prostate shows low positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: Plakophilin 2 Antibody [NBP1-86078] - Staining of human heart muscle, liver, prostate and testis using Anti-Plakophilin 2 antibody NBP1-86078 (A) shows similar protein distribution across ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Plakophilin 2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VGNGNLHRTSSVPEYVYNLHLVENDFVGGRSPVPKTYDMLKAGTTATYEGRWGRGTAQYSSQKSVEERSLRHPLRRLEISPDSSPERAHYTHSDYQYSQRSQAGHTLHHQESRRAALLVPPRY
Specificity
Specificity of human Plakophilin 2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PKP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04 - 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Plakophilin 2 Protein (NBP1-86078PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Plakophilin 2 Antibody

  • ARVD9
  • MGC177501
  • plakophilin 2
  • plakophilin-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-49879
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
AF947
Species: Hu
Applications: WB, Simple Western
NBP1-85710
Species: Hu
Applications: IHC, IHC-P
MAB7265
Species: Mu
Applications: WB, IHC
NBP2-92546
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-37557
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-85383
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90042
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-48309
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC, ICC
AF944
Species: Hu
Applications: WB, IHC
NBP1-97674
Species: Hu, Mu, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00008502-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-84132
Species: Hu
Applications: IHC, IHC-P
NBP1-90042
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89416
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92192
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00005729-B01P
Species: Hu
Applications: WB, Flow, ICC/IF

Publications for Plakophilin 2 Antibody (NBP1-86078) (0)

There are no publications for Plakophilin 2 Antibody (NBP1-86078).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Plakophilin 2 Antibody (NBP1-86078) (0)

There are no reviews for Plakophilin 2 Antibody (NBP1-86078). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Plakophilin 2 Antibody (NBP1-86078) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Plakophilin 2 Products

Bioinformatics Tool for Plakophilin 2 Antibody (NBP1-86078)

Discover related pathways, diseases and genes to Plakophilin 2 Antibody (NBP1-86078). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Plakophilin 2 Antibody (NBP1-86078)

Discover more about diseases related to Plakophilin 2 Antibody (NBP1-86078).
 

Pathways for Plakophilin 2 Antibody (NBP1-86078)

View related products by pathway.

PTMs for Plakophilin 2 Antibody (NBP1-86078)

Learn more about PTMs related to Plakophilin 2 Antibody (NBP1-86078).

Blogs on Plakophilin 2

There are no specific blogs for Plakophilin 2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Plakophilin 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PKP2