Home » Plakophilin 2 » Plakophilin 2 Research Products » Plakophilin 2 Antibody

Plakophilin 2 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: Plakophilin 2 Antibody [NBP1-86078] - Analysis in human cell lines Caco-2 and SK-MEL-30. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Orthogonal Strategies: Western Blot: Plakophilin 2 Antibody [NBP1-86078] - Analysis in human cell lines Caco-2 and SK-MEL-30. Corresponding RNA-seq data are presented for the same cell lines. Loading control: ...read more
Immunocytochemistry/ Immunofluorescence: Plakophilin 2 Antibody [NBP1-86078] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cell junctions. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Plakophilin 2 Antibody [NBP1-86078] - Analysis in human heart muscle and liver tissues using NBP1-86078 antibody. Corresponding Plakophilin 2 RNA-seq data are presented for the same ...read more
Immunohistochemistry-Paraffin: Plakophilin 2 Antibody [NBP1-86078] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: Plakophilin 2 Antibody [NBP1-86078] - Staining of human liver.
Immunohistochemistry-Paraffin: Plakophilin 2 Antibody [NBP1-86078] - Staining of human kidney.
Immunohistochemistry-Paraffin: Plakophilin 2 Antibody [NBP1-86078] - Staining of human testis.
Immunohistochemistry-Paraffin: Plakophilin 2 Antibody [NBP1-86078] - Staining of human heart muscle using Anti-PKP2 antibody NBP1-86078.
Immunohistochemistry-Paraffin: Plakophilin 2 Antibody [NBP1-86078] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: Plakophilin 2 Antibody [NBP1-86078] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: Plakophilin 2 Antibody [NBP1-86078] - Staining of human prostate shows low positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: Plakophilin 2 Antibody [NBP1-86078] - Staining of human heart muscle, liver, prostate and testis using Anti-Plakophilin 2 antibody NBP1-86078 (A) shows similar protein distribution across ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

Plakophilin 2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VGNGNLHRTSSVPEYVYNLHLVENDFVGGRSPVPKTYDMLKAGTTATYEGRWGRGTAQYSSQKSVEERSLRHPLRRLEISPDSSPERAHYTHSDYQYSQRSQAGHTLHHQESRRAALLVPPRY
Specificity
Specificity of human Plakophilin 2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PKP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.04 - 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Plakophilin 2 Protein (NBP1-86078PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Plakophilin 2 Antibody

  • ARVD9
  • MGC177501
  • plakophilin 2
  • plakophilin-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Desmoplakin
Antibody
NBP1-49879
Immunohistochemistry-Paraffin: Desmoplakin Antibody [NBP1-49879] - Paraffin embedded Human Heart. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
(2 Publications)
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Desmoglein-2
Antibody [Unconjugate
AF947
Simple Western lane view shows lysates of A431 human epithelial carcinoma cell line and A549 human lung carcinoma cell line, loaded at 0.2 mg/mL. A specific band was detected for Desmoglein‑2 at approximately 159-164 kDa (as indicated) using 5 µg/mL of Goat Anti-Human Desmoglein‑2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF947) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Western blot shows lysates of A431 human epithelial carcinoma cell line and A549 human lung carcinoma cell line. PVDF membrane was probed with 0.25 µg/mL of Goat Anti-Human Desmoglein‑2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF947) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). Specific bands were detected for Desmoglein‑2 at approximately 90-160 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(4 Publications)
Species: Hu
Applications: WB, Simple Western
Desmocollin-2
Antibody
NBP1-85710
Immunohistochemistry-Paraffin: Desmocollin-2 Antibody [NBP1-85710] - Staining of human colon shows moderate membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: Desmocollin-2 Antibody [NBP1-85710] - Staining of human kidney shows low expression as expected.
Immunohistochemistry-Paraffin: Desmocollin-2 Antibody [NBP1-85710] - Staining in human esophagus and cerebral cortex tissues.. Corresponding DSC2 RNA-seq data are presented for the same tissues.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
Desmocollin-3
Antibody (765129)
MAB7265
Western blot shows lysates of mouse skin tissue and mouse embryo (15 d.p.c.) tissue. PVDF membrane was probed with 1 µg/mL of Rat Anti-Mouse Desmocollin‑3 Monoclonal Antibody (Catalog # MAB7265) followed by HRP-conjugated Anti-Rat IgG Secondary Antibody (Catalog # HAF005). Specific bands were detected for Desmocollin‑3 at approximately 95-110 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Desmocollin‑3 was detected in perfusion fixed frozen sections of mouse embryo (15 d.p.c.) using Rat Anti-Mouse Desmocollin‑3 Monoclonal Antibody (Catalog # MAB7265) at 25 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS017) and counterstained with hematoxylin (blue). Specific staining was localized to plasma membrane and cytoplasm in epidermis. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
(1 Review)
Species: Mu
Applications: WB, IHC
DSPP Antibody
NBP2-92546
Western Blot: DSPP Antibody [NBP2-92546] - Analysis of extracts of various cell lines, using DSPP at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.
Immunocytochemistry/Immunofluorescence: DSPP Antibody [NBP2-92546] - Analysis of U-2 OS cells using DSPP. Blue: DAPI for nuclear staining.
Immunocytochemistry/Immunofluorescence: DSPP Antibody [NBP2-92546] - Analysis of H9C2 cells using DSPP. Blue: DAPI for nuclear staining.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
TGF-beta 3
[Unconjugated]
8420-B3/CF
TGF-beta 3 [Unconjugated]
(3 Publications)
Species: Hu
gamma Catenin
Antibody (4C12)
NBP2-37557
Western Blot: gamma Catenin Antibody (4C12) [NBP2-37557] - Western blot analysis using JUP mouse mAb against T47D (1), MCF-7 (2), SKBR-3 (3), A431 (4) and HEK293 (5) cell lysate.
Immunocytochemistry/Immunofluorescence: gamma Catenin Antibody (4C12) [NBP2-37557] - Immunofluorescence analysis of U251 cells using JUP mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye.
Immunohistochemistry: gamma Catenin Antibody (4C12) [NBP2-37557] - Immunohistochemical analysis of paraffin-embedded stomach cancer tissues using JUP mouse mAb with DAB staining.
(2 Publications)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
p120-catenin
Antibody
NBP1-85383
Western Blot: p120-catenin Antibody [NBP1-85383] - Analysis using Anti-CTNND1 antibody NBP1-85383 (A) shows similar pattern to independent antibody NBP2-38130 (B).
Immunocytochemistry/Immunofluorescence: p120-catenin Antibody [NBP1-85383] - Staining of human cell line A-431 shows localization to plasma membrane. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: p120-catenin Antibody [NBP1-85383] - Staining of human small intestine shows cytoplasmic and membranous positivity in glandular cells.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Plakophilin 1
Antibody
NBP1-90042
Western Blot: Plakophilin 1 Antibody [NBP1-90042] - Analysis using Anti-PKP1 antibody NBP1-90042 (A) shows similar pattern to independent antibody NBP1-90041 (B).
Immunocytochemistry/Immunofluorescence: Plakophilin 1 Antibody [NBP1-90042] - Immunofluorescent staining of human cell line PC-3 shows localization to nucleoplasm & plasma membrane.
Immunohistochemistry-Paraffin: Plakophilin 1 Antibody [NBP1-90042] - Staining in human skin and skeletal muscle tissues using anti-PKP1 antibody. Corresponding PKP1 RNA-seq data are presented for the same tissues.
(1 Publication)
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
N-Cadherin
Antibody (13A9)
NBP1-48309
Immunocytochemistry: N-Cadherin Antibody (13A9) [NBP1-48309] - Immunostaining of original tumor, low passage, and high passage KCI-MENG1 cells. The original patient-derived tumor (top row) showed moderate and patchy immunoreactivity for epithelial membrane antigen (EMA); strong and diffuse immunostaining for progesterone receptor (PR); and a Ki-67 proliferative index of 2-3%. There was also strong immunostaining for N-cadherin and vimentin. KCI-MENG1-LP cells (middle row) and KCI-MENG1-HP cells (bottom row) maintained expression of EMA, N-cadherin, and vimentin but had significantly reduced PR expression compared to the original tumor. Whereas Ki-67 labeling was found in only a small number of cells in the original tumor and low passage cells, it was positive in virtually all P84 cells. Scale bar 50 um. Image collected and cropped by CiteAb from the following publication (http://www.translational-medicine.com/content/13/1/227), licensed under a CC-BY licence.
Western Blot: N-Cadherin Antibody (13A9) [NBP1-48309] - Analysis of N-Cadherin expression in HeLa whole cell lysate.
Immunocytochemistry: N-Cadherin Antibody (13A9) [NBP1-48309] - Human meningioma mouse xenograft model KCI-MENG1-LPSX generated with the spontaneously immortal cell line KCI-MENG1-LP. Tumors from immunocompromised SCID mice were dissected and the derivative cell line KCI-MENG1-LPSX CL was generated. The EMA, PR, and N-cadherin IHC of the mouse tumor highly resembled the original patient-derived tumor. The vimentin- and Ki-67-stained cells in the mouse tumor tissue were markedly more abundant and more intensely stained than in the original tumor. KCI-MENG1-LPSX CL cells displayed the same patterns of immunostaining as the high passage parent cell line KCI-MENG1-HP, including the loss of PR staining. Scale bar 50 um. Image collected and cropped by CiteAb from the following publication (http://www.translational-medicine.com/content/13/1/227), licensed under a CC-BY licence.
(1 Review)
(33 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC, ICC
Desmoglein-1
Antibody [Unconjugate ...
AF944
Desmoglein‑1 was detected in immersion fixed paraffin-embedded sections of human skin using Goat Anti-Human Desmoglein‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF944) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(2 Publications)
Species: Hu
Applications: WB, IHC
Plakophilin-3
Antibody (23E3/4)
NBP1-97674
Immunohistochemistry: Plakophilin-3 Antibody (23E3/4) [NBP1-97674] - IHC localization of plakophilin-3 in hair root sheath of dog skin.
Immunohistochemistry: Plakophilin-3 Antibody (23E3/4) [NBP1-97674] - IHC localization of plakophilin-3 in hair root sheath of dog skin.
Species: Hu, Mu, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Plakophilin 4
Antibody (1B2)
H00008502-M01
Western Blot: Plakophilin 4 Antibody (1B2) [H00008502-M01] - Detection against Immunogen (36.63 KDa).
(1 Publication)
Species: Hu
Applications: WB, ELISA, ICC/IF
TMEM43 Antibody
NBP1-84132
Immunohistochemistry-Paraffin: TMEM43 Antibody [NBP1-84132] - Staining of human skin shows moderate to strong positivity in nuclear membrane in keratinocytes.
Immunohistochemistry-Paraffin: TMEM43 Antibody [NBP1-84132] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: TMEM43 Antibody [NBP1-84132] - Staining of human prostate shows weak positivity in nuclear membrane in glandular cells, as well as in smooth muscle cells.
(2 Publications)
Species: Hu
Applications: IHC, IHC-P
Plakophilin 1
Antibody
NBP1-90042
Western Blot: Plakophilin 1 Antibody [NBP1-90042] - Analysis using Anti-PKP1 antibody NBP1-90042 (A) shows similar pattern to independent antibody NBP1-90041 (B).
Immunocytochemistry/Immunofluorescence: Plakophilin 1 Antibody [NBP1-90042] - Immunofluorescent staining of human cell line PC-3 shows localization to nucleoplasm & plasma membrane.
Immunohistochemistry-Paraffin: Plakophilin 1 Antibody [NBP1-90042] - Staining in human skin and skeletal muscle tissues using anti-PKP1 antibody. Corresponding PKP1 RNA-seq data are presented for the same tissues.
(1 Publication)
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NSUN5 Antibody
NBP1-89416
Western Blot: NSUN5 Antibody [NBP1-89416] - Analysis in human cell lines Caco-2 and U-251MG using anti-NSUN5 antibody. Corresponding NSUN5 RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.
Immunocytochemistry/Immunofluorescence: NSUN5 Antibody [NBP1-89416] - Staining of human cell line A-431 shows positivity in nucleus and nucleoli. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: NSUN5 Antibody [NBP1-89416] - Staining of human rectum shows strong nuclear and cytoplasmic positivity in glandular cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NOL1 Antibody
NBP1-92192
Western Blot: NOL1 Antibody [NBP1-92192] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/Immunofluorescence: NOL1 Antibody [NBP1-92192] - Staining of human cell line A-431 shows localization to nucleoli. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: NOL1 Antibody [NBP1-92192] - Staining of human skin shows distinct nucleolar positivity in keratinocytes.
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
PTGDR Antibody
H00005729-B01P
Western Blot: PTGDR Antibody [H00005729-B01P] - Analysis of PTGDR expression in transfected 293T cell line by PTGDR polyclonal antibody. Lane 1: PTGDR transfected lysate(39.6 KDa). Lane 2: Non-transfected lysate.
Flow Cytometry: PTGDR Antibody [H00005729-B01P] - Analysis of negative control 293 cells (Black) and PTGDR expressing 293 cells (Green) using PTGDR purified mouse polyclonal antibody.
(2 Publications)
Species: Hu
Applications: WB, Flow, ICC/IF

Publications for Plakophilin 2 Antibody (NBP1-86078) (0)

There are no publications for Plakophilin 2 Antibody (NBP1-86078).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Plakophilin 2 Antibody (NBP1-86078) (0)

There are no reviews for Plakophilin 2 Antibody (NBP1-86078). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Plakophilin 2 Antibody (NBP1-86078) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional Plakophilin 2 Products

Bioinformatics Tool for Plakophilin 2 Antibody (NBP1-86078)

Discover related pathways, diseases and genes to Plakophilin 2 Antibody (NBP1-86078). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Plakophilin 2 Antibody (NBP1-86078)

Discover more about diseases related to Plakophilin 2 Antibody (NBP1-86078).
 

Pathways for Plakophilin 2 Antibody (NBP1-86078)

View related products by pathway.

PTMs for Plakophilin 2 Antibody (NBP1-86078)

Learn more about PTMs related to Plakophilin 2 Antibody (NBP1-86078).

Blogs on Plakophilin 2

There are no specific blogs for Plakophilin 2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Plakophilin 2 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol PKP2