Synaptophysin Antibody

Images

 
Western Blot: Synaptophysin Antibody [NBP1-88112] - Analysis in human cerebral cortex tissue.
Immunohistochemistry-Paraffin: Synaptophysin Antibody [NBP1-88112] - Staining of human cerebral cortex shows distinct positivity in neuropil.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Synaptophysin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DMDVVNQLVAGGQFRVVKEPLGFVKVLQWAAPSVL
Marker
Pre-synaptic marker
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SYP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Synaptophysin Protein (NBP1-88112PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Synaptophysin Antibody

  • Major synaptic vesicle protein p38
  • MRX
  • MRXSYP
  • Synaptophysin
  • SYP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-58870
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NB120-15160
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-25147
Species: Hu, Mu, Rt, Bv, Xp
Applications: WB, Simple Western, ICC/IF
NBP2-15184
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB300-213
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr
NB300-143
Species: Hu, Mu, Rt, Po, Ca, Ch, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NB120-15200
Species: Hu, Mu, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
H00054474-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-45224
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
NB500-517
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-29403
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-05164
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P

Publications for Synaptophysin Antibody (NBP1-88112) (0)

There are no publications for Synaptophysin Antibody (NBP1-88112).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Synaptophysin Antibody (NBP1-88112) (0)

There are no reviews for Synaptophysin Antibody (NBP1-88112). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Synaptophysin Antibody (NBP1-88112) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Synaptophysin Products

Bioinformatics Tool for Synaptophysin Antibody (NBP1-88112)

Discover related pathways, diseases and genes to Synaptophysin Antibody (NBP1-88112). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Synaptophysin Antibody (NBP1-88112)

Discover more about diseases related to Synaptophysin Antibody (NBP1-88112).
 

Pathways for Synaptophysin Antibody (NBP1-88112)

View related products by pathway.

PTMs for Synaptophysin Antibody (NBP1-88112)

Learn more about PTMs related to Synaptophysin Antibody (NBP1-88112).
 

Research Areas for Synaptophysin Antibody (NBP1-88112)

Find related products by research area.

Blogs on Synaptophysin.

Synaptophysin a Marker Protein in Neuroendocrine Cells
Synaptophysin a Marker Protein in Neuroendocrine CellsSynaptophysin is a major integral membrane glycoprotein of neuronal synaptic vesicles present in virtually all synapses and shows a high degree of evolutionary conservation across the mammals. Sy...  Read full blog post.

Characterizing Synaptophysin is "a Snap"
Synaptophysin is an integral membrane glycoprotein found within the small synaptic vesicles in brain and endocrine cells. Studies with synaptophysin antibodies show that it is one of the most abundant small vesicle proteins, constituting approximately...  Read full blog post.

Synaptophysin and Dementing Disorders
 Synaptophysin (a presynaptic vesicle protein) is an integral membrane glycoprotein originally isolated from presynaptic vesicles of bovine neurons. Synaptophysin is found in all nerve terminals and synaptophysin measurements have been used to quantif...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Synaptophysin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SYP
Entrez