S100A1 Antibody

Images

 
Western Blot: S100A1 Antibody [NBP1-87103] - Analysis in control (vector only transfected HEK293T lysate) and S100A1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry-Paraffin: S100A1 Antibody [NBP1-87103] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.
Western Blot: S100A1 Antibody [NBP1-87103] - Analysis in human cell line SK-MEL-30.
Immunohistochemistry-Paraffin: S100A1 Antibody [NBP1-87103] - Staining of human heart muscle shows moderate to strong nuclear positivity in cardiomyocytes.
Orthogonal Strategies: Immunohistochemistry-Paraffin: S100A1 Antibody [NBP1-87103] - Staining in human heart muscle and lymph node tissues.. Corresponding S100A1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: S100A1 Antibody [NBP1-87103] - Staining of human lymph node shows no positivity in non - germinal center cells as expected.
Immunohistochemistry-Paraffin: S100A1 Antibody [NBP1-87103] - Staining of human skin shows moderate to strong cytoplasmic positivity in melanocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

S100A1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS
Predicted Species
Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
S100A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
IHC reported in scientific literature (PMID: 26259611). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
S100A1 Protein (NBP1-87103PEP)
Publications
Read Publication using
NBP1-87103 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 26259611).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for S100A1 Antibody

  • protein S100-A1
  • S100 alpha
  • S100 calcium binding protein A1
  • S100 calcium-binding protein A1S100
  • S-100 protein alpha chain
  • S-100 protein subunit alpha
  • S100 protein, alpha polypeptide
  • S100A
  • S100A1
  • S100-alpha

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-223
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Eq
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq, Gp, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
AF3844
Species: Hu, Mu
Applications: IHC
AF3059
Species: Mu
Applications: WB, Simple Western, ICC
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF2065
Species: Mu
Applications: WB, Simple Western, IHC, ICC
NB110-58870
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, KD
NBP2-45267
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB120-22711
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-683
Species: Hu, Mu, Rt
Applications: WB, EM, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP2-16382
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB110-93274
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
H00006275-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB300-653
Species: Hu, Mu, Rt, Ch, Fe, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-46603
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-14871
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-15669
Species: Hu, Mu, Rt
Applications: WB, IHC

Publications for S100A1 Antibody (NBP1-87103)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for S100A1 Antibody (NBP1-87103) (0)

There are no reviews for S100A1 Antibody (NBP1-87103). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for S100A1 Antibody (NBP1-87103) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional S100A1 Products

Bioinformatics Tool for S100A1 Antibody (NBP1-87103)

Discover related pathways, diseases and genes to S100A1 Antibody (NBP1-87103). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for S100A1 Antibody (NBP1-87103)

Discover more about diseases related to S100A1 Antibody (NBP1-87103).
 

Pathways for S100A1 Antibody (NBP1-87103)

View related products by pathway.

PTMs for S100A1 Antibody (NBP1-87103)

Learn more about PTMs related to S100A1 Antibody (NBP1-87103).
 

Research Areas for S100A1 Antibody (NBP1-87103)

Find related products by research area.

Blogs on S100A1

There are no specific blogs for S100A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our S100A1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol S100A1