Serpin A1/alpha 1-Antitrypsin Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309] - Analysis in human kidney and cerebral cortex tissues using NBP1-90309 antibody. Corresponding SERPINA1 ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309] - Staining of human cerebral cortex, kidney, placenta and testis using Anti-SERPINA1 antibody NBP1-90309 ...read more
Independent Antibodies: Western Blot: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309] - Analysis using Anti-SERPINA1 antibody NBP1-90309 (A) shows similar pattern to independent antibody NBP1-90308 (B).
Immunocytochemistry/ Immunofluorescence: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309] - Staining of human cell line Hep G2 shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309] - Assessment of CCL18 and A1AT (Serpin A1/alpha 1-Antitrypsin) in bladder tissue. Representative immunostaining of benign bladder for A1AT ...read more
Western Blot: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309] - Analysis in human plasma.
Immunohistochemistry-Paraffin: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309] - Staining of human testis shows moderate positivity in plasma.
Immunohistochemistry-Paraffin: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309] - Staining of human kidney shows moderate positivity in plasma.
Immunohistochemistry-Paraffin: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309] - Staining of human placenta shows strong positivity in plasma in blood vessels.
Immunohistochemistry-Paraffin: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Immunohistochemistry: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309] - Representative expression status for SERPINA1 level in benign tissue. All images were captured at 400x magnification. Image collected and ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Serpin A1/alpha 1-Antitrypsin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: HDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYGAPHR
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SERPINA1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500-1:5000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Serpin A1/alpha 1-Antitrypsin Protein (NBP1-90309PEP)
Publications
Read Publications using
NBP1-90309 in the following applications:

  • GS
    1 publication
  • 2 publications
  • IHC
    1 publication
  • 4 publications
  • WB
    2 publications

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25211665).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Serpin A1/alpha 1-Antitrypsin Antibody

  • A1A
  • A1AT
  • AATMGC23330
  • alpha 1-Antitrypsin
  • alpha 1-Proteinase Inhibitor
  • Alpha-1 protease inhibitor
  • Alpha-1-antiproteinase
  • alpha-1-antitrypsin
  • antitrypsin), member 1
  • member 1
  • PIMGC9222
  • serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase
  • serine (or cysteine) proteinase inhibitor, clade A, member 1
  • Serpin A1
  • serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
MAB7665
Species: Hu
Applications: IHC, WB
MAB9167
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
DCRP00
Species: Hu
Applications: ELISA
MAB1368
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, KO, Simple Western, WB
NBP2-52559
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
2914-HT
Species: Hu
Applications: BA
MAB4470
Species: All-Multi
Applications: ICC, IHC, WB
AF1938
Species: Hu
Applications: ICC, IP, Simple Western, WB
DHAPG0
Species: Hu
Applications: ELISA
NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-61118
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
H00138428-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NB200-540
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP3-15868
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
D6050
Species: Hu
Applications: ELISA
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP1-81838
Species: Hu, Mu
Applications: IHC, IHC-P, WB
AF5739
Species: Hu, Mu, Rt
Applications: WB

Publications for Serpin A1/alpha 1-Antitrypsin Antibody (NBP1-90309)(9)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 5 applications: GS, ICC/IF, IHC, IHC-P, WB.


Filter By Application
GS
(1)
ICC/IF
(2)
IHC
(1)
IHC-P
(4)
WB
(2)
All Applications
Filter By Species
Human
(9)
All Species
Showing Publications 1 - 9 of 9.
Publications using NBP1-90309 Applications Species
Furuya H, Chan O, Hokutan K, et al. Prognostic Significance of Lymphocyte Infiltration and a Stromal Immunostaining of a Bladder Cancer Associated Diagnostic Panel in Urothelial Carcinoma Diagnostics Dec 28 2019 [PMID: 31905599] (IHC-P, Human) IHC-P Human
Connolly B, Isaacs C et al. SERPINA1 mRNA as a Treatment for Alpha-1 Antitrypsin Deficiency. J Nucleic Acids Jul 17 2018 [PMID: 30009048] (GS, Human) GS Human
Shen S, Sanchez ME, Blomenkamp K et al. Amelioration of Alpha-1 Antitrypsin Deficiency Diseases with Genome Editing in Transgenic Mice Hum. Gene Ther. Jun 22 2018 [PMID: 29641323] (IHC-P, Human) IHC-P Human
Kwon CH, Park HJ, Choi JH et al. Snail and serpinA1 promote tumor progression and predict prognosis in colorectal cancer. Oncotarget 2015 Aug 21 [PMID: 26015410] (WB, Human) WB Human
Zhang G, Gomes-Giacoia E, Dai Y et al. Validation and clinicopathologic associations of a urine-based bladder cancer biomarker signature. Diagn Pathol. 2014 Nov 12 [PMID: 25387487] (IHC-P, Human) IHC-P Human
Kwon CH, Park HJ, Lee JR et al. Serpin peptidase inhibitor clade A member 1 is a biomarker of poor prognosis in gastric cancer. Br J Cancer 2014 Nov 11 [PMID: 25211665] (IHC, WB, Human) IHC, WB Human
Miyake M, Ross S, Lawton A et al. Investigation of CCL18 and A1AT as potential urinary biomarkers for bladder cancer detection. BMC Urol. 2013 Sep 5 [PMID: 24011266] (IHC-P, Human) IHC-P Human
Rosenecker J, Guan S, Darmstädter M, Xu C In Vitro Investigations on Optimizing and Nebulization of IVT-mRNA Formulations for Potential Pulmonary Based Alpha-1-Antitrypsin Deficiency Treatment Research Square Jan 6 2021 (ICC/IF, Human) ICC/IF Human
Guan S, DarmstAdter M, Xu C, Rosenecker J In Vitro Investigations on Optimizing and Nebulization of IVT-mRNA Formulations for Potential Pulmonary-Based Alpha-1-Antitrypsin Deficiency Treatment Pharmaceutics Aug 17 2021 [PMID: 34452241] (ICC/IF, Human) ICC/IF Human

Reviews for Serpin A1/alpha 1-Antitrypsin Antibody (NBP1-90309) (0)

There are no reviews for Serpin A1/alpha 1-Antitrypsin Antibody (NBP1-90309). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Serpin A1/alpha 1-Antitrypsin Antibody (NBP1-90309) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Serpin A1/alpha 1-Antitrypsin Products

Bioinformatics Tool for Serpin A1/alpha 1-Antitrypsin Antibody (NBP1-90309)

Discover related pathways, diseases and genes to Serpin A1/alpha 1-Antitrypsin Antibody (NBP1-90309). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Serpin A1/alpha 1-Antitrypsin Antibody (NBP1-90309)

Discover more about diseases related to Serpin A1/alpha 1-Antitrypsin Antibody (NBP1-90309).
 

Pathways for Serpin A1/alpha 1-Antitrypsin Antibody (NBP1-90309)

View related products by pathway.

PTMs for Serpin A1/alpha 1-Antitrypsin Antibody (NBP1-90309)

Learn more about PTMs related to Serpin A1/alpha 1-Antitrypsin Antibody (NBP1-90309).
 

Research Areas for Serpin A1/alpha 1-Antitrypsin Antibody (NBP1-90309)

Find related products by research area.

Blogs on Serpin A1/alpha 1-Antitrypsin

There are no specific blogs for Serpin A1/alpha 1-Antitrypsin, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Serpin A1/alpha 1-Antitrypsin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SERPINA1