Serpin A1/alpha 1-Antitrypsin Antibody

Images

 
Western Blot: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309] - Analysis in human plasma.
Immunocytochemistry/ Immunofluorescence: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309] - Staining of human cell line Hep G2 shows localization to vesicles.
Immunohistochemistry-Paraffin: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309] - Staining of human kidney shows moderate extra-cellular positivity in cells in tubules and positivity of plasma in blood vessel.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Serpin A1/alpha 1-Antitrypsin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYGAPHR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SERPINA1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:2500-1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Serpin A1/alpha 1-Antitrypsin Protein (NBP1-90309PEP)
Publications
Read Publications using
NBP1-90309 in the following applications:

  • IHC
    1 publication
  • 2 publications
  • WB
    2 publications

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25211665).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Serpin A1/alpha 1-Antitrypsin Antibody

  • A1A
  • A1AT
  • AATMGC23330
  • alpha 1-Antitrypsin
  • alpha 1-Proteinase Inhibitor
  • Alpha-1 protease inhibitor
  • Alpha-1-antiproteinase
  • alpha-1-antitrypsin
  • antitrypsin), member 1
  • member 1
  • PIMGC9222
  • serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase
  • serine (or cysteine) proteinase inhibitor, clade A, member 1
  • Serpin A1
  • serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-35213
Species: Hu
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
NBP2-52559
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
AF1938
Species: Hu
Applications: WB, Simple Western, IP, ICC
AF4409
Species: Mu
Applications: WB
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-61118
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86713
Species: Hu
Applications: IHC, IHC-P
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-12553
Species: Hu
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF5739
Species: Hu, Mu, Rt
Applications: WB

Publications for Serpin A1/alpha 1-Antitrypsin Antibody (NBP1-90309)(4)

Reviews for Serpin A1/alpha 1-Antitrypsin Antibody (NBP1-90309) (0)

There are no reviews for Serpin A1/alpha 1-Antitrypsin Antibody (NBP1-90309). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Serpin A1/alpha 1-Antitrypsin Antibody (NBP1-90309) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Serpin A1/alpha 1-Antitrypsin Products

Bioinformatics Tool for Serpin A1/alpha 1-Antitrypsin Antibody (NBP1-90309)

Discover related pathways, diseases and genes to Serpin A1/alpha 1-Antitrypsin Antibody (NBP1-90309). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Serpin A1/alpha 1-Antitrypsin Antibody (NBP1-90309)

Discover more about diseases related to Serpin A1/alpha 1-Antitrypsin Antibody (NBP1-90309).
 

Pathways for Serpin A1/alpha 1-Antitrypsin Antibody (NBP1-90309)

View related products by pathway.

PTMs for Serpin A1/alpha 1-Antitrypsin Antibody (NBP1-90309)

Learn more about PTMs related to Serpin A1/alpha 1-Antitrypsin Antibody (NBP1-90309).
 

Research Areas for Serpin A1/alpha 1-Antitrypsin Antibody (NBP1-90309)

Find related products by research area.

Blogs on Serpin A1/alpha 1-Antitrypsin

There are no specific blogs for Serpin A1/alpha 1-Antitrypsin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Serpin A1/alpha 1-Antitrypsin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SERPINA1
Entrez