Haptoglobin Antibody (7C1N2)

Western Blot: Haptoglobin Antibody (7C1N2) [NBP3-16700] - Western blot analysis of extracts of various cell lines, using Haptoglobin (HP) Rabbit mAb (NBP3-16700) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 10s.

Immunohistochemistry: Haptoglobin Antibody (7C1N2) [NBP3-16700] - Immunofluorescence analysis of rat liver using Haptoglobin (HP) Rabbit mAb (NBP3-16700) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunohistochemistry-Paraffin: Haptoglobin Antibody (7C1N2) [NBP3-16700] - Immunohistochemistry of paraffin-embedded human liver cancer using Haptoglobin (HP) Rabbit mAb (NBP3-16700) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunocytochemistry/ Immunofluorescence: Haptoglobin Antibody (7C1N2) [NBP3-16700] - Immunofluorescence analysis of paraffin-embedded rat liver using Haptoglobin (HP) Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: Haptoglobin Antibody (7C1N2) [Haptoglobin] - Immunofluorescence analysis of paraffin-embedded rat liver using Haptoglobin (HP) Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC
• Clone: 7C1N2
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Haptoglobin Antibody (7C1N2) Summary

• Description: Novus Biologicals Rabbit Haptoglobin Antibody (7C1N2) (NBP3-16700) is a recombinant monoclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 307-406 of human Haptoglobin (P00738). DQCIRHYEGSTVPEKKTPKSPVGVQPILNEHTFCAGMSKYQEDTCYGDAGSAFAVHDLEEDTWYATGILSFDKSCAVAEYGVYVKVTSIQDWVQKTIAEN
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: HP
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 45 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Haptoglobin Antibody (7C1N2)

• binding peptide
• BP
• haptoglobin alpha(1S)-beta
• haptoglobin alpha(2FS)-beta
• Haptoglobin
• haptoglobin, alpha polypeptide
• haptoglobin, beta polypeptide
• HP
• HP-1
• hp2-alpha
• HP2ALPHA2
• HPA1S
• MGC111141
• zonulin

Background

Haptoglobin combines with free plasma hemoglobin, preventing loss of iron through the kidneys and protecting the kidneys from damage by hemoglobin, while making the hemoglobin accessible to degradative enzymes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HP