PTRH1 Antibody

Images

 
Immunohistochemistry-Paraffin: PTRH1 Antibody [NBP1-86713] - Staining of human soft tissue shows weak cytoplasmic positivity in adipocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PTRH1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VYLVHDELDKPLGRLALKLGGSARGHNGVRSCISCLNSNAMPRLRVGIGRPAHPEAVQAHVLGCFSPAEQELLPLLLDRATD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PTRH1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PTRH1 Protein (NBP1-86713PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PTRH1 Antibody

  • C9orf115
  • chromosome 9 open reading frame 115
  • EC 3.1.1.29
  • MGC51999
  • peptidyl-tRNA hydrolase 1 homolog (S. cerevisiae)
  • probable peptidyl-tRNA hydrolase
  • PTH
  • PTH1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NBP1-05164
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NB300-164
Species: Hu, Po, Ca, Rt(-)
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-56505
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
2629-FG/CF
Species: Mu
NB120-19347
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IF
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-40067
Species: Hu, Mu, Po, Bv, Ca, Eq, Mk, Pm
Applications: WB, ICC/IF, IHC-P
NB110-3638
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-42378
Species: Hu
Applications: WB, IHC
NBP1-89134
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for PTRH1 Antibody (NBP1-86713) (0)

There are no publications for PTRH1 Antibody (NBP1-86713).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PTRH1 Antibody (NBP1-86713) (0)

There are no reviews for PTRH1 Antibody (NBP1-86713). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PTRH1 Antibody (NBP1-86713) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PTRH1 Products

Bioinformatics Tool for PTRH1 Antibody (NBP1-86713)

Discover related pathways, diseases and genes to PTRH1 Antibody (NBP1-86713). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on PTRH1

There are no specific blogs for PTRH1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PTRH1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PTRH1