Glutaminyl-peptide Cyclotransferase/QPCT Antibody

Images

 
Western Blot: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Analysis in human cell line SK-MEL-30.
Immunohistochemistry-Paraffin: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Staining of human adrenal gland shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Glutaminyl-peptide Cyclotransferase/QPCT Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
QPCT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Glutaminyl-peptide Cyclotransferase/QPCT Protein (NBP1-81838PEP)
Publications
Read Publication using
NBP1-81838 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (84%). Mouse reactivity reported in scientific literature (PMID: 26447138).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Glutaminyl-peptide Cyclotransferase/QPCT Antibody

  • EC 2.3.2.5
  • GCT
  • Glutaminyl cyclase
  • glutaminyl-peptide cyclotransferase
  • Glutaminyl-tRNA cyclotransferase
  • Glutamyl cyclase
  • QCEC
  • QPCT
  • sQC

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-15771
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
796-IC
Species: Mu
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-33855
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for Glutaminyl-peptide Cyclotransferase/QPCT Antibody (NBP1-81838)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for Glutaminyl-peptide Cyclotransferase/QPCT Antibody (NBP1-81838) (0)

There are no reviews for Glutaminyl-peptide Cyclotransferase/QPCT Antibody (NBP1-81838). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Glutaminyl-peptide Cyclotransferase/QPCT Antibody (NBP1-81838). (Showing 1 - 1 of 1 FAQ).

  1. Have you tested QPCT Antibody (NBP1-81838) on mice?
    • This antibody has only been tested with human, but the sequence recognized by this antibody shares 85% similarity with mouse. It may cross-react but we can not guarantee it. If you would like to test the antibody in mouse you may be interested in our Innovators Reward Program; through this program if you complete an online review with image, detailing your positive or negative results we will send you a discount voucher for 100% of the purchase price of the reviewed product.

Secondary Antibodies

 

Isotype Controls

Additional Glutaminyl-peptide Cyclotransferase/QPCT Products

Bioinformatics Tool for Glutaminyl-peptide Cyclotransferase/QPCT Antibody (NBP1-81838)

Discover related pathways, diseases and genes to Glutaminyl-peptide Cyclotransferase/QPCT Antibody (NBP1-81838). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Glutaminyl-peptide Cyclotransferase/QPCT Antibody (NBP1-81838)

Discover more about diseases related to Glutaminyl-peptide Cyclotransferase/QPCT Antibody (NBP1-81838).
 

Pathways for Glutaminyl-peptide Cyclotransferase/QPCT Antibody (NBP1-81838)

View related products by pathway.

PTMs for Glutaminyl-peptide Cyclotransferase/QPCT Antibody (NBP1-81838)

Learn more about PTMs related to Glutaminyl-peptide Cyclotransferase/QPCT Antibody (NBP1-81838).

Blogs on Glutaminyl-peptide Cyclotransferase/QPCT

There are no specific blogs for Glutaminyl-peptide Cyclotransferase/QPCT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Glutaminyl-peptide Cyclotransferase/QPCT Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol QPCT
Entrez
Uniprot