JMJD2B Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit JMJD2B Antibody - BSA Free (NBP3-38192) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-365 of human JMJD2B (NP_055830.1).
Sequence: RAVSLGQVVITKNRNGLYYRCRVIGAASQTCYEVNFDDGSYSDNLYPESITSRDCVQLGPPSEGELVELRWTDGNLYKAKFISSVTSHIYQVEFEDGSQLTVKRGDIFTLEEELP |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
KDM4B |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Western Blot 1:500 - 1:1000
|
| Theoretical MW |
122 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.09% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for JMJD2B Antibody - BSA Free
Background
JMJD2B is a member of the jumonji (jmj) domain containing gene family of histone demethylases that plays a role in chromatin regulation and influences transcriptional activation and suppression. JMJD2B has been shown to be capable of antagonizing H3K9 trimethylation.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ICC/IF, IP, WB
Species: Hu, Mu
Applications: ChIP, ChIP, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IP, KO, WB
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC, IHC-P, Single-Cell Western, WB
Species: Bv, Ca, Fe, Ma, Hu, Pm, Mu, Po, Pm, Rb, Rt, Sh, Xp
Applications: ChIP, ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, KO, LA, PLA, Simple Western, TCS, WB
Species: Hu, Mu
Applications: IP, WB
Species: Hu, Mu, Pm
Applications: ChIP, ELISA, IHC, IHC-P, KD, Simple Western, WB
Species: Bv, Ca, Hu, Mu, Pm
Applications: WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, WB
Species: Hu, Mu, Pl, Rt
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, MiAr, PLA, Simple Western, WB
Species: Hu, Mu
Applications: IHC, Simple Western, WB
Species: Hu, Mu
Applications: DirELISA, IHC, IP, WB
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ChIP, ChIP, ICC/IF (-), WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: WB
Publications for JMJD2B Antibody (NBP3-38192) (0)
There are no publications for JMJD2B Antibody (NBP3-38192).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for JMJD2B Antibody (NBP3-38192) (0)
There are no reviews for JMJD2B Antibody (NBP3-38192).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for JMJD2B Antibody (NBP3-38192) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional JMJD2B Products
Research Areas for JMJD2B Antibody (NBP3-38192)
Find related products by research area.
|
Blogs on JMJD2B