NANOGP8 Antibody

Images

 
Western Blot: NANOGP8 Antibody [H00388112-B01P] - Analysis of NANOGP8 expression in transfected 293T cell line by NANOGP8 polyclonal antibody. Lane 1: NANOGP8 transfected lysate(33.55 KDa). Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

NANOGP8 Antibody Summary

Immunogen
NANOGP8 (AAH69807, 1 a.a. - 305 a.a.) full-length human protein. MSVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQDSPDSSTSPKGKQPTSAENSVAKKEDKVPVKKQKTRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTYPSLYSSYHQGCLVNPTGNLPMWSNQTWNNSTWSNQTQNIQSWSNHSWNTQTWCTQSWNNQAWNSPFYNCGEESLQSCMHFQPNSPASDLEAALEAAGEGLNVIQQTTRYFSTPQTMDLFLNYSMNMQPEDV
Specificity
NANOGP8 - Nanog homeobox pseudogene 8,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
NANOGP8
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
Application Notes
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NANOGP8 Antibody

  • MGC119250
  • Nanog homeobox pseudogene 8
  • NANOG
  • NANOGP1
  • PN8

Background

NANOGP8 may act as a transcription regulator. When overexpressed, promotes cells to enter into S phase and proliferation. Expressed in tumor uterine cervix, breast and urinary bladder tissues, and also osteosarcoma, hepatoma, and breast adenocarcinoma cancer cell lines.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NANOGP8 Antibody (H00388112-B01P) (0)

There are no publications for NANOGP8 Antibody (H00388112-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NANOGP8 Antibody (H00388112-B01P) (0)

There are no reviews for NANOGP8 Antibody (H00388112-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NANOGP8 Antibody (H00388112-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NANOGP8 Products

Research Areas for NANOGP8 Antibody (H00388112-B01P)

Find related products by research area.

Blogs on NANOGP8.

KLF4 as a transcription factor in stem cell differentiation
Kru¨ppel-like factors (KLFs) are evolutionarily conserved zinc finger transcription factors that play a role in cell differentiation, proliferation, and pluripotency. KLF4 has specifically been tied to many diverse cellular processes, including sel...  Read full blog post.

mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NANOGP8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NANOGP8
Entrez