FoxP3 Antibody - BSA Free

Staining of human cell line MCF-7 shows localization to nucleoplasm & cytosol.

• Reactivity: Hu, Mu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FoxP3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit FoxP3 Antibody - BSA Free (NBP3-25325) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein FoxP3 using the following amino acid sequence: GCEKVFEEPEDFLKHCQADHLLDEKGRAQCLLQREMVQSLEQQLVLEKEKLSAMQAHLAGKMALTKASSVAS
• Predicted Species: Mouse (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FOXP3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 µg/ml
• Application Notes: For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for FoxP3 Antibody - BSA Free

• AIID
• AIIDMGC141961
• DIETER
• forkhead box P3
• Forkhead Box Protein P3
• FoxP3
• FOXP3delta7
• immune dysregulation, polyendocrinopathy, enteropathy, X-linked
• Immunodeficiency, Polyendocrinopathy, Enteropathy, X-Linked
• IPEX
• JM2
• MGC141961
• MGC141963
• PIDX
• PIDXMGC141963
• SCURFIN
• XPID
• XPIDpolyendocrinopathy, enteropathy, X-linked

Background

Forkhead box P3 (FoxP3), aka Scurfin and JM2, is a protein involving in immune system responses and functioning as a transcriptional regulator crucial in the development and inhibitory of regulatory T-Cells (Treg). FoxP3 is a master regulator of the Treg lineage, who requires Ahr and STAT-5 and other additional transcription factors to retains its complete function and differentiation. Scurfin remains steady and constitutively expressed in two conditions: a high level in CD25 + CD4 positive regulatory T cells and a low level in CD4 positive/CD25 negative cells. JM2 is absent in CD4 negative/CD8 positive T cells. FoxP3 defects are related to various cancers and autoimmune diseases, and X-linked syndrome (IPEX), while overexpression may also cause severe immunodeficiency.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for FoxP3 Antibody (NBP3-25325). (Showing 1 - 2 of 2 FAQ).

1. Does FoxP3 antibodies comes in lyophilized form?
   • FoxP3 antibodies, aka JM2 IPEX, and Scurfin antibodies, have the following products in lyophilized form: NBP1-18319, AF3240.
2. What the theoretical molecular weight for FoxP3 antibodies?
   • The TMW of FoxP3 antibodies is approximately 47 - 52 kDa.

Bioinformatics

• Gene Symbol: FOXP3