Clusterin/APOJ Antibody - BSA Free

Staining of human cell line EFO-21 shows localization to cytosol.

Analysis in human cell line RT-4 and human cell line U-251 MG.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Clusterin/APOJ Antibody - BSA Free Summary

• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein Clusterin/APOJ using the following amino acid sequence: KEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDH
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CLU
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 µg/ml
  • Western Blot 0.04-0.4 µg/ml
• Application Notes: For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Clusterin/APOJ Antibody - BSA Free

• 40
• 40, sulfated glycoprotein 2
• Aging-associated gene 4 protein
• aging-associated protein 4
• APOJ
• apo-J
• Apolipoprotein J
• CLI
• CLIclusterin (complement lysis inhibitor, SP-40
• CLU
• Clusterin
• Complement cytolysis inhibitor
• complement lysis inhibitor
• Complement-associated protein SP-40
• Ku70-binding protein 1
• KUB1SGP2
• MGC24903
• NA1/NA2
• SGP-2
• SP-40
• sulfated glycoprotein 2
• Testosterone-repressed prostate message 2
• testosterone-repressed prostate message 2, apolipoprotein J)
• TRPM-2
• TRPM-2TRPM2

Background

Clusterin, also designated complement lysis inhibitor (CLI), apolipoprotein J (APOJ), sulfated glycoprotein 2 (SGP2), SP-40 and testosterone-repressed prostate message 2 (TRPM2), is a secretory, heterodimeric glycoprotein that influences immune regulation, cell adhesion, transformation, lipid transportation, tissue remodeling, membrane recycling and cell-cell interactions. Clusterin is synthesized as a 449 amino acid poly-peptide that is posttranslationally cleaved at an internal bond between Arg 227 and Ser 228. Two subunits, alpha and beta, are associated through disulfide bonds. The beta subunit (also called ApoJalpha) corresponds to residues 23-227. The alpha subunit (also called ApoJbeta) corresponds to residues 228-449. Overexpression of Clusterin appears to be more common in late stages of mammary tumor progression. Clusterin markedly influences beta-Amyloid structure and neuritic toxicity in vivo and may influence Alzheimer's disease pathogenesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CLU