TBP like protein TLP Antibody


Immunocytochemistry/ Immunofluorescence: TBP like protein TLP Antibody [NBP2-49671] - Staining of human cell line SK-MEL-30 shows localization to nucleus & nucleoli.
Orthogonal Strategies: Immunohistochemistry-Paraffin: TBP like protein TLP Antibody [NBP2-49671] - Staining in human testis and liver tissues using anti-TBPL1 antibody. Corresponding TBPL1 RNA-seq data are ...read more
Immunohistochemistry-Paraffin: TBP like protein TLP Antibody [NBP2-49671] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: TBP like protein TLP Antibody [NBP2-49671] - Staining of human testis shows high expression.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC
Validated by:

Orthogonal Strategies


Order Details

TBP like protein TLP Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: DADSDVALDILITNVVCVFRTRCHLNLRKIALEGANVIYKRDVGKVLMKLRKPRITATIWSSGKIICTGATSEEEAKFGARR
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TBP like protein TLP Recombinant Protein Antigen (NBP2-49671PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for TBP like protein TLP Antibody

  • 21 kDa TBP-like protein
  • STUD21-kDA TBP-like protein
  • TATA box binding protein-related factor 2
  • TATA box-binding protein-like protein 1
  • TATA box-binding protein-related factor 2
  • TBP-like 1
  • TBP-like factor
  • TBP-like protein 1
  • TBP-related factor 2
  • TBP-related protein
  • TLFMGC:8389
  • TLP21
  • TLPMGC:9620
  • TRF2Second TBP of unique DNA protein
  • TRP


Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes a protein that serves the same function as TBP and substitutes for TBP at some promoters that are not recognized by TFIID. It is essential for spermiogenesis and believed to be important in expression of developmentally regulated genes.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TBP like protein TLP Antibody (NBP2-49671) (0)

There are no publications for TBP like protein TLP Antibody (NBP2-49671).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TBP like protein TLP Antibody (NBP2-49671) (0)

There are no reviews for TBP like protein TLP Antibody (NBP2-49671). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TBP like protein TLP Antibody (NBP2-49671) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional TBP like protein TLP Products

Research Areas for TBP like protein TLP Antibody (NBP2-49671)

Find related products by research area.

Blogs on TBP like protein TLP

There are no specific blogs for TBP like protein TLP, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TBP like protein TLP Antibody and receive a gift card or discount.


Gene Symbol TBPL1