TBP like protein TLP Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TBP like protein TLP Antibody [NBP2-49671] - Staining of human cell line SK-MEL-30 shows localization to nucleus & nucleoli.
Orthogonal Strategies: Immunohistochemistry-Paraffin: TBP like protein TLP Antibody [NBP2-49671] - Staining in human testis and liver tissues using anti-TBPL1 antibody. Corresponding TBPL1 RNA-seq data are ...read more
Immunohistochemistry-Paraffin: TBP like protein TLP Antibody [NBP2-49671] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: TBP like protein TLP Antibody [NBP2-49671] - Staining of human testis shows high expression.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

TBP like protein TLP Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: DADSDVALDILITNVVCVFRTRCHLNLRKIALEGANVIYKRDVGKVLMKLRKPRITATIWSSGKIICTGATSEEEAKFGARR
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TBPL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TBP like protein TLP Recombinant Protein Antigen (NBP2-49671PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TBP like protein TLP Antibody

  • 21 kDa TBP-like protein
  • STUD21-kDA TBP-like protein
  • TATA box binding protein-related factor 2
  • TATA box-binding protein-like protein 1
  • TATA box-binding protein-related factor 2
  • TBP-like 1
  • TBP-like factor
  • TBP-like protein 1
  • TBP-related factor 2
  • TBP-related protein
  • TLFMGC:8389
  • TLP21
  • TLPMGC:9620
  • TRF2Second TBP of unique DNA protein
  • TRP

Background

Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes a protein that serves the same function as TBP and substitutes for TBP at some promoters that are not recognized by TFIID. It is essential for spermiogenesis and believed to be important in expression of developmentally regulated genes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67232
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-1617
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB110-57130
Species: ChHa, Hu, Mu, Pm, Rt
Applications: ChIP, DB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
NB110-40763
Species: Gp, Hu, Mu, Rt, Ze
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NB110-68281
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF (-), Simple Western, WB
NBP1-97311
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NB100-98844
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NB110-74960
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-77262
Species: Hu, Mu
Applications: ELISA, IF, IHC, IHC-P, WB
NBP1-77260
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
664-LI/CF
Species: Hu
Applications: BA
NB110-81601
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-88370
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-81838
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-15669
Species: Hu, Mu, Rt
Applications: IHC, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB

Publications for TBP like protein TLP Antibody (NBP2-49671) (0)

There are no publications for TBP like protein TLP Antibody (NBP2-49671).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TBP like protein TLP Antibody (NBP2-49671) (0)

There are no reviews for TBP like protein TLP Antibody (NBP2-49671). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TBP like protein TLP Antibody (NBP2-49671) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TBP like protein TLP Products

Bioinformatics Tool for TBP like protein TLP Antibody (NBP2-49671)

Discover related pathways, diseases and genes to TBP like protein TLP Antibody (NBP2-49671). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TBP like protein TLP Antibody (NBP2-49671)

Discover more about diseases related to TBP like protein TLP Antibody (NBP2-49671).
 

Pathways for TBP like protein TLP Antibody (NBP2-49671)

View related products by pathway.

PTMs for TBP like protein TLP Antibody (NBP2-49671)

Learn more about PTMs related to TBP like protein TLP Antibody (NBP2-49671).
 

Research Areas for TBP like protein TLP Antibody (NBP2-49671)

Find related products by research area.

Blogs on TBP like protein TLP

There are no specific blogs for TBP like protein TLP, but you can read our latest blog posts.
Download our IHC Handbook

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TBP like protein TLP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TBPL1