TYRP1 Antibody

Images

 
Western Blot: TYRP1 Antibody [NBP1-88370] - Analysis in control (vector only transfected HEK293T lysate) and TYRP1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: TYRP1 Antibody [NBP1-88370] - Staining of human cell line SK-MEL-30 shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: TYRP1 Antibody [NBP1-88370] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Western Blot: TYRP1 Antibody [NBP1-88370] - Analysis in human cell line SK-MEL-30.
Orthogonal Strategies: Immunohistochemistry-Paraffin: TYRP1 Antibody [NBP1-88370] - Analysis in human skin and cerebral cortex tissues. Corresponding TYRP1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: TYRP1 Antibody [NBP1-88370] - Staining of human endometrium shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: TYRP1 Antibody [NBP1-88370] - Staining of human rectum shows moderate to strong cytoplasmic positivity in a subset of glandular cells and cells in stroma.
Immunohistochemistry-Paraffin: TYRP1 Antibody [NBP1-88370] - Staining of human skin shows moderate to strong cytoplasmic positivity in melanocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

TYRP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VCDICTDDLMGSRSNFDSTLISPNSVFSQWRVVCDSLEDYDTLGTLCNSTEDGPIRRNPAGNVARPMVQRLPEPQDVAQCLEVGLFDTPPFYSNSTNSFRNTVEGYSDPTGKYDPAVRSLH
Specificity
Specificity of human TYRP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TYRP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TYRP1 Protein (NBP1-88370PEP)
Publications
Read Publications using
NBP1-88370 in the following applications:

Reactivity Notes

Mouse reactivity reported in scientific literature (Shridhar et al).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TYRP1 Antibody

  • b-PROTEIN
  • CAS25,6-dihydroxyindole-2-carboxylic acid oxidase
  • Catalase B
  • CATB
  • EC 1.14.18
  • EC 1.14.18.-
  • EC 1.14.18.1
  • Glycoprotein 75
  • GP75DHICA oxidase
  • Melanoma antigen gp75
  • TRP-1
  • TRPTYRP
  • tyrosinase-related protein 1TRP1
  • TYRRP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67233
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-86892
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1617
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB110-40763
Species: Hu, Mu, Rt, Gp, Ze
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56561
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-69571
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-97311
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-41262
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-77262
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P, IF
NBP1-00142
Species: Hu, Mu
Applications: WB, IP, PEP-ELISA
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-98844
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-20989
Species: Hu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NB110-81601
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-88370
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TYRP1 Antibody (NBP1-88370)(2)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 2 applications: ICC/IF, WB.


Filter By Application
ICC/IF
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
Mouse
(1)
All Species
Showing Publications 1 - 2 of 2.
Publications using NBP1-88370 Applications Species
Mengoni M, Braun AD, Gaffal E, Tuting T C9orf72 in myeloid cells suppresses STING-induced inflammation Int. J. Cancer Aug 13 2020 [PMID: 32790916] (WB, Human) WB Human
Shridhar N Novel vaccination strategies for CD4+ T cell immunotherapy of melanoma Thesis (ICC/IF, Mouse) ICC/IF Mouse

Reviews for TYRP1 Antibody (NBP1-88370) (0)

There are no reviews for TYRP1 Antibody (NBP1-88370). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TYRP1 Antibody (NBP1-88370) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TYRP1 Products

Bioinformatics Tool for TYRP1 Antibody (NBP1-88370)

Discover related pathways, diseases and genes to TYRP1 Antibody (NBP1-88370). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TYRP1 Antibody (NBP1-88370)

Discover more about diseases related to TYRP1 Antibody (NBP1-88370).
 

Pathways for TYRP1 Antibody (NBP1-88370)

View related products by pathway.

PTMs for TYRP1 Antibody (NBP1-88370)

Learn more about PTMs related to TYRP1 Antibody (NBP1-88370).

Blogs on TYRP1.

Winter is coming, and TRPM8 welcomes the cold!
TRPM8, or transient receptor potential melastatin 8, is a nonselective cation channel that is activated by cold environments and menthol-like cooling compounds.  While TRPM8 is best known for its location in peripheral nerve endings, it has functio...  Read full blog post.

Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TYRP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TYRP1