| Description | Novus Biologicals Rabbit TYRP1 Antibody - BSA Free (NBP1-88370) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-TYRP1 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VCDICTDDLMGSRSNFDSTLISPNSVFSQWRVVCDSLEDYDTLGTLCNSTEDGPIRRNPAGNVARPMVQRLPEPQDVAQCLEVGLFDTPPFYSNSTNSFRNTVEGYSDPTGKYDPAVRSLH |
| Predicted Species | Rat (91%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TYRP1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publications using NBP1-88370 | Applications | Species |
|---|---|---|
| Shridhar N Novel vaccination strategies for CD4+ T cell immunotherapy of melanoma Thesis (WB, Mouse) | WB | Mouse |
| Shridhar N Novel vaccination strategies for CD4+ T cell immunotherapy of melanoma Thesis (ICC/IF, Mouse) | ICC/IF | Mouse |
| Li MY, Flora P, Pu H Et al. UV-induced reduction in Polycomb repression promotes epidermal pigmentation Developmental cell 2021-08-30 [PMID: 34473941] | ||
| Mengoni M, Braun AD, Gaffal E, Tuting T C9orf72 in myeloid cells suppresses STING-induced inflammation Int. J. Cancer 2020-08-13 [PMID: 32790916] (WB, Human) | WB | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for TYRP1 Antibody (NBP1-88370)Find related products by research area.
|
|
Winter is coming, and TRPM8 welcomes the cold! TRPM8, or transient receptor potential melastatin 8, is a nonselective cation channel that is activated by cold environments and menthol-like cooling compounds. While TRPM8 is best known for its location in peripheral nerve endings, it has functio... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TYRP1 |