Clusterin/APOJ Antibody - BSA Free

Immunohistochemistry-Paraffin: Clusterin/APOJ Antibody [NBP1-90128] - Staining in human epididymis and skeletal muscle tissues using anti-CLU antibody. Corresponding CLU RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Clusterin/APOJ Antibody [NBP1-90128] - Staining of human skeletal muscle shows low expression as expected.

Immunohistochemistry-Paraffin: Clusterin/APOJ Antibody [NBP1-90128] - Staining of human epididymis shows high expression.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Clusterin/APOJ Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CLU
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Clusterin/APOJ Protein (NBP1-90128PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID:16524965).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Clusterin/APOJ Antibody - BSA Free

• 40
• 40, sulfated glycoprotein 2
• Aging-associated gene 4 protein
• aging-associated protein 4
• APOJ
• apo-J
• Apolipoprotein J
• CLI
• CLIclusterin (complement lysis inhibitor, SP-40
• CLU
• Clusterin
• Complement cytolysis inhibitor
• complement lysis inhibitor
• Complement-associated protein SP-40
• Ku70-binding protein 1
• KUB1SGP2
• MGC24903
• NA1/NA2
• SGP-2
• SP-40
• sulfated glycoprotein 2
• Testosterone-repressed prostate message 2
• testosterone-repressed prostate message 2, apolipoprotein J)
• TRPM-2
• TRPM-2TRPM2

Background

Clusterin, also designated complement lysis inhibitor (CLI), apolipoprotein J (APOJ), sulfated glycoprotein 2 (SGP2), SP-40 and testosterone-repressed prostate message 2 (TRPM2), is a secretory, heterodimeric glycoprotein that influences immune regulation, cell adhesion, transformation, lipid transportation, tissue remodeling, membrane recycling and cell-cell interactions. Clusterin is synthesized as a 449 amino acid poly-peptide that is posttranslationally cleaved at an internal bond between Arg 227 and Ser 228. Two subunits, alpha and beta, are associated through disulfide bonds. The beta subunit (also called ApoJalpha) corresponds to residues 23-227. The alpha subunit (also called ApoJbeta) corresponds to residues 228-449. Overexpression of Clusterin appears to be more common in late stages of mammary tumor progression. Clusterin markedly influences beta-Amyloid structure and neuritic toxicity in vivo and may influence Alzheimer's disease pathogenesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Clusterin/APOJ Antibody (NBP1-90128)(3)

Publications using NBP1-90128

• Guantes R, Rastrojo A, Neves R et al. Global variability in gene expression and alternative splicing is modulated by mitochondrial content. Genome Res 2015-05-01 [PMID: 25800673]
• Kato BS, Nicholson G, Neiman M et al. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Sci 2011-11-17 [PMID: 22093360]
• Ek S, Andreasson U, Hober S et al. From gene expression analysis to tissue microarrays: a rational approach to identify therapeutic and diagnostic targets in lymphoid malignancies. Mol Cell Proteomics 2006-06-01 [PMID: 16524965]

Bioinformatics

• Gene Symbol: CLU