CD44 Antibody - Azide and BSA Free

Western Blot: CD44 Antibody [NBP2-92947] - Analysis of extracts of various cell lines, using CD44 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 10s.

Immunocytochemistry/Immunofluorescence: CD44 Antibody [NBP2-92947] - Analysis of RAW264.7 cells using CD44 at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunohistochemistry-Paraffin: CD44 Antibody [NBP2-92947] - Human lung cancer using CD44 Rabbit pAb at dilution of 1:250 (40x lens).

Immunocytochemistry/Immunofluorescence: CD44 Antibody [NBP2-92947] - Analysis of A431 cells using CD44 at dilution of 1:200. Blue: DAPI for nuclear staining.

Immunocytochemistry/Immunofluorescence: CD44 Antibody [NBP2-92947] - Analysis of HeLa cells using CD44 at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunocytochemistry/Immunofluorescence: CD44 Antibody [NBP2-92947] - Analysis of HeLa cells using CD44 at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunohistochemistry-Paraffin: CD44 Antibody [NBP2-92947] - Human esophageal cancer using CD44 Rabbit pAb at dilution of 1:250 (40x lens).

Western Blot: CD44 Antibody [NBP2-92947] - Analysis of extracts of HeLa cells, using CD44 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 10s.

• Reactivity: Hu, Mu
• Applications: WB, ELISA, ICC/IF, IHC, KO
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

CD44 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Knockout (KO) Validated Rabbit CD44 Antibody - Azide and BSA Free (NBP2-92947) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 20-178 of human CD44 (NP_000601.3). AQIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CD44
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 μg/mL.
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockout Validated
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 82 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for CD44 Antibody - Azide and BSA Free

• CD44 antigen
• CD44 molecule (Indian blood group)
• CD44
• CD44R
• CDw44
• cell surface glycoprotein CD44
• chondroitin sulfate proteoglycan 8
• CSPG8
• ECMR-III
• epican
• Extracellular matrix receptor III
• GP90 lymphocyte homing/adhesion receptor
• HCAM
• HCELL
• hematopoietic cell E- and L-selectin ligand
• Heparan sulfate proteoglycan
• Hermes antigen
• homing function and Indian blood group system
• HUTCH-I
• Hyaluronate receptor
• IN
• LHR
• MC56
• MDU2
• MDU2CD44 antigen (homing function and Indian blood group system)
• MDU3
• MDU3CDW44
• MIC4
• MIC4MGC10468
• MUTCH-I
• Pgp1
• PGP-1
• PGP-I
• Phagocytic glycoprotein 1
• Phagocytic glycoprotein I

Background

CD44 represents a family of type I transmembrane glycoproteins expressed on many cell types such as B cells, monocytes, macrophages, and variable subsets of thymocytes and peripheral T cells. CD44 primarily functions as an adhesion molecule. It has been implicated in various processes, such as hematopoiesis, lymphocyte homing, leukocyte activation, tumor metastasis and development. The KM201 monoclonal antibody reacts with an epitope very close to the hyaluronate binding domain on the CD44 molecule. KM201 can inhibit hyaluronate-dependent cell aggregation, prevent lympho-hemopoiesis in both Dexter and Whitlock-Witte Cultures, prevent the earliest intrathymic precursors from homing to the thymus, and costimulate the activation of freshly purified splenic CD4+ T cells.1-6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CD44