| Description | Novus Biologicals Rabbit Carbonic Anhydrase IX/CA9 Antibody - BSA Free (NBP2-54743) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This Carbonic Anhydrase IX/CA9 Antibody was developed against a recombinant protein corresponding to amino acids: PCAQGVIWTVFNQTVMLSAKQLHTLSDTLWGPGDSRLQLNFRATQPLNGRVIEASFPAGVDSSPRAAEPVQLNSCL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CA9 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Carbonic Anhydrase IX/CA9 Antibody (NBP2-54743)Find related products by research area.
|
|
Understanding ‘Y’ in Breast Cancer: Crucial Role of DNA/RNA-binding Protein YB-1 in the Development, Pre-Invasive, and Metastatic Phases Jamshed Arslan, Pharm D, PhD In the United States, 1 in 8 women will be diagnosed with breast cancer in her lifetime.1 Despite the prevalence, cancer genesis is a mystery. The heterogeneity of cancers makes it diff... Read full blog post. |
|
Carbonic anhydrase IX (CAIX) - a reliable histochemical marker of hypoxia Carbonic anhydrase IX is a member of the carbonic anhydrase family. This family consists of catalytic enzymes capable of converting carbon dioxide and water into carbonic acid, protons, and bicarbonate ions. This family of molecules is abundantly e... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CA9 |