We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

HYPB Antibody - Azide and BSA Free

Images

 
Immunocytochemistry/ Immunofluorescence: HYPB Antibody [NBP3-03807] - Analysis of U-2 OS cells using HYPB antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: HYPB Antibody [NBP3-03807] - Analysis of C6 cells using HYPB antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Western Blot: HYPB Antibody [NBP3-03807] - analysis of lysates from Mouse spleen, using SETD2 Rabbit pAb at 1:900 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug ...read more
Immunoprecipitation- HYPB Antibody [NBP3-03807] - Analysis of 600 μg extracts of Mouse spleen using 3 μg SETD2 antibody. Western blot was performed from the immunoprecipitate using SETD2 antibody at a dilution of ...read more
Immunohistochemistry: HYPB Antibody - Azide and BSA Free [HYPB] - Immunohistochemistry analysis of paraffin-embedded Rat testis tissue using HYPB Rabbit pAb at a dilution of 1:1000 (40x lens). High pressure antigen ...read more
Immunohistochemistry: HYPB Antibody - Azide and BSA Free [HYPB] - Immunohistochemistry analysis of paraffin-embedded Human spleen tissue using HYPB Rabbit pAb at a dilution of 1:1000 (40x lens). High pressure antigen ...read more
Immunohistochemistry: HYPB Antibody - Azide and BSA Free [HYPB] - Immunohistochemistry analysis of paraffin-embedded Human kidney tissue using HYPB Rabbit pAb at a dilution of 1:1000 (40x lens). High pressure antigen ...read more
Immunohistochemistry: HYPB Antibody - Azide and BSA Free [HYPB] - Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using HYPB Rabbit pAb at a dilution of 1:1000 (40x lens). High pressure antigen ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IP
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
Azide and BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

HYPB Antibody - Azide and BSA Free Summary

Immunogen
A synthetic peptide corresponding to a sequence within amino acids 2475-2564 of human HYPB (NP_054878.5). RKEMSQFIVQCLNPYRKPDCKVGRITTTEDFKHLARKLTHGVMNKELKYCKNPEDLECNENVKHKTKEYIKKYMQKFGAVYKPKEDTELE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SETD2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 1:50-1:200
  • Immunoprecipitation 0.5ug-4ug antibody for 400ug-600ug extracts of whole cells
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for HYPB Antibody - Azide and BSA Free

  • FLJ22472
  • FLJ23184
  • FLJ45883
  • FLJ46217
  • HIF1
  • HIF-1EC 2.1.1.43
  • HIP-1
  • histone-lysine N-methyltransferase SETD2
  • hSET2
  • huntingtin interacting protein 1
  • Huntingtin yeast partner B
  • Huntingtin-interacting protein 1
  • Huntingtin-interacting protein B
  • HYPBp231HBP
  • KIAA1732SET domain-containing protein 2
  • KMT3AHBP231
  • Lysine N-methyltransferase 3A
  • SET domain containing 2
  • SET2FLJ16420

Background

Huntington's disease (HD), a neurodegenerative disorder characterized by loss of striatal neurons, is caused by an expansion of a polyglutamine tract in the HD protein huntingtin. This gene encodes a protein belonging to a class of huntingtin interacting proteins characterized by WW motifs. This protein is a histone methyltransferase that is specific for lysine-36 of histone H3, and methylation of this residue is associated with active chromatin. This protein also contains a novel transcriptional activation domain and has been found associated with hyperphosphorylated RNA polymerase II. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-105
Species: Bv, Ca, Fe, Ma, Hu, Pm, Mu, Po, Pm, Rb, Rt, Sh, Xp
Applications: ChIP, ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, In vitro, KD, KO, LA, PLA, Simple Western, TCS, WB
DVE00
Species: Hu
Applications: ELISA
NB100-124
Species: Bv, Ma, Hu, Mu, Pm, Rt, Sh
Applications: ChIP, CHIP-SEQ, GS, IB, ICC/IF, IHC,  IHC-P, IP, WB
MEP00B
Species: Mu
Applications: ELISA
NBP2-45411
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NB110-39113
Species: Hu, Mu, Rb, Rt
Applications: ChIP, ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, Simple Western, WB
DTM100
Species: Hu
Applications: ELISA
NB100-122
Species: Fi, Ha, Hu, Mu, Pm, Rb, Rt, Re, Sh
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, In vitro, KD, KO, PAGE, Simple Western, WB
NBP3-07388
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB600-607
Species: Hu, Rt
Applications: ELISA, IHC,  IHC-P, WB
MAB1230
Species: Hu, Mu, Rt
Applications: ICC, IHC, KO, Simple Western, WB
NB300-605
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, WB
NB100-417
Species: Hu, Mu, Pl, Rt
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, MiAr, PLA, Simple Western, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
NBP2-19804
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
NBP3-03807
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP

Publications for HYPB Antibody (NBP3-03807) (0)

There are no publications for HYPB Antibody (NBP3-03807).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HYPB Antibody (NBP3-03807) (0)

There are no reviews for HYPB Antibody (NBP3-03807). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HYPB Antibody (NBP3-03807) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HYPB Antibody - Azide and BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol SETD2