BDNF Antibody - BSA Free

Images

 
Western Blot: BDNF Antibody [NBP1-59304] - ANT-DBS inhibited BDNF-TrkB pathway and its downstream regulator in the hippocampus of epileptic monkeys. Analysis of BDNF (1:1000, NBP1-59304), TrkB (1:500, NPB1-47898), ...read more
Immunohistochemistry: BDNF Antibody [NBP1-59304] - Ventral horn region of mouse spinal cord. Concentration 1:200
Western Blot: BDNF Antibody [NBP1-59304] - ACHN Whole Cell lysates.
Western Blot: BDNF Antibody [NBP1-59304] - Human Liver cell lysate, concentration 0.2-1 ug/ml.
Western Blot: BDNF Antibody [NBP1-59304] - ACHN Whole Cell lysates, Antibody Dilution: 1 ug/ml.
Western Blot: BDNF Antibody [NBP1-59304] - Fetal Liver lysates, Antibody Dilution: 0.5 ug/ml.
Western Blot: BDNF Antibody [NBP1-59304] - Sample Tissue: Human ACHN Antibody Dilution: 1.0 ug/ml
Immunohistochemistry: BDNF Antibody [NBP1-59304] - Rhesus macaque spinal cord. Concentration1:300.
Western Blot: BDNF Antibody [NBP1-59304] - Simvastatin treatment increases BDNF expression in primary cortical neurons of AS mice. (A) Primary cultured cortical neurons prepared from wild type & AS embryos were treated ...read more
Simvastatin treatment increases BDNF expression in primary cortical neurons of AS mice. (A) Primary cultured cortical neurons prepared from wild type and AS embryos were treated with 5 μM simvastatin at DIV14 for 12 h. ...read more

Product Details

Summary
Reactivity Hu, Mu, Pm, RMSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Concentration
0.5 mg/ml

Order Details

BDNF Antibody - BSA Free Summary

Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptides corresponding to BDNF(brain-derived neurotrophic factor) The peptide sequence was selected from the middle region of BDNF. Peptide sequence EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BDNF
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry 1:200- 1:500
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml
Application Notes
Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID:31849603).
Publications
Read Publications using
NBP1-59304 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for BDNF Antibody - BSA Free

  • Abrineurin
  • ANON2
  • BDNF
  • brain-derived neurotrophic factor
  • BULN2
  • MGC34632
  • Neurotrophin

Background

BDNF is a member of the nerve growth factor family. It is induced by cortical neurons, and is necessary for survival of striatal neurons in the brain. Expression BDNF is reduced in both Alzheimer's and Huntington disease patients. BDNF may play a role in the regulation of stress response and in the biology of mood disorders.The protein encoded by this gene is a member of the nerve growth factor family. It is induced by cortical neurons, and is necessary for survival of striatal neurons in the brain. Expression of this gene is reduced in both Alzheimer's and Huntington disease patients. This gene may play a role in the regulation of stress response and in the biology of mood disorders. Multiple transcript variants encoding distinct isoforms have been described for this gene, but the full-length nature of only some could be determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

267-N3
Species: Hu
Applications: BA
AF1494
Species: Hu, Mu, Rt
Applications: Block, IHC, Simple Western, WB
256-GF
Species: Hu
Applications: BA
AF1056
Species: Rt
Applications: IHC, WB
268-N4
Species: Hu
Applications: BA
AF1157
Species: Mu
Applications: IHC, WB
212-GD
Species: Hu
Applications: Bind, BA
H00007170-M02
Species: Hu
Applications: ELISA, IHC,  IHC-P, S-ELISA, WB
AF1404
Species: Mu, Rt
Applications: Block, IHC, Simple Western, WB
257-NT
Species: Hu
Applications: BA
MAB3468
Species: Hu
Applications: ICC, WB
H00001523-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
DRT200
Species: Hu
Applications: ELISA
H00003059-M02
Species: Hu
Applications: ELISA, IHC,  IHC-P, KD, PLA, S-ELISA, WB
MAB224
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
NBP1-18910
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
AF1138
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut, WB
233-FB
Species: Hu
Applications: BA

Publications for BDNF Antibody (NBP1-59304)(4)

We have publications tested in 2 confirmed species: Mouse, Rhesus Macaque.

We have publications tested in 2 applications: ICC/IF, WB.


Filter By Application
ICC/IF
(1)
WB
(1)
All Applications
Filter By Species
Mouse
(1)
Rhesus Macaque
(1)
All Species

Reviews for BDNF Antibody (NBP1-59304) (0)

There are no reviews for BDNF Antibody (NBP1-59304). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for BDNF Antibody (NBP1-59304). (Showing 1 - 1 of 1 FAQs).

  1. I have ordered the BDNF Antibody (CAT: NBP1-59304) from you all and was curious if the antibody had been tested as to whether or not it can recognize the pro-BDNF form of the BDNF protein in addition to the mature cleaved BDNF form.
    • The immunogen lies within the range of aa 145-195. Therefore the antibody will detect full length and the cleaved form range 129-247.          Signal peptide 1 – 18                                                                                                                                                       Propeptide 19 – 128                                                                                                                                                              Chain 129 – 247 Brain-derived neurotrophic factorhttp://www.uniprot.org/uniprot/P23560ImmunogenSynthetic peptides corresponding to BDNF(brain-derived neurotrophic factor) The peptide sequence was selected from the middle region of BDNF. Peptide sequence145 EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG 195

Secondary Antibodies

 

Isotype Controls

Additional BDNF Products

Research Areas for BDNF Antibody (NBP1-59304)

Find related products by research area.

Blogs on BDNF. Showing 1-10 of 11 blog posts - Show all blog posts.


  Read full blog post.

The use of a GFP antibody for research applications in transgenic C. elegans, GFP tagged yeast and porcine model
GFP, or green fluorescent protein, is a chemiluminescent protein derived from Aequorea jellyfish that was first discovered by Osamu Shimomura.  It was soon after established that the emission spectra of GFP was right around 509nm, or the ultraviol...  Read full blog post.

The identification of dopaminergic neurons using Tyrosine Hydroxylase in Parkinson's research and LRRK2
Tyrosine hydroxylase (TH) is a crucial enzyme involved in the biosynthesis of dopamine, norepinephrine and epinephrine in the brain.  Specifically, TH catalyzes the conversion of l-tyrosine to l-dihydroxyphenylalanine (l-dopa).  The importance of t...  Read full blog post.

Niemann Pick-C1 and cholesterol dynamics
Niemann-Pick type C1 (NPC1) mediates low-density cholesterol transport from late endosomes and lysosomes to other areas of the cell via receptor mediation endocytosis.  Although cholesterol moves freely inside the cell, it cannot independently expo...  Read full blog post.

Synapsin I: Implicated in synaptic activity across a diverse range of studies
Synapsins are a family of neuronal proteins that are most renowned for their activity in modulating the pre-synaptic terminal.  Synapsin’s behavior is regulated by protein kinases and phosphatases, which alter the way that synapsin’s i...  Read full blog post.

TrkB: Bridging Ontogenesis and Oncogenesis
Tropomyosin receptor kinase B (TrkB) is a member of the Trk receptor tyrosine kinases family consisting of TrkA, TrkB and TrkC. The sequence of these family members is highly conserved. Interaction of brain-derived neurotrophic factor (BDNF) with its ...  Read full blog post.

TrkB and Nervous System Function
Neutrophins and their receptors play an important role in regulating the development of both the central and peripheral nervous systems. Neurotrophin ligand binding to each of their respective Trk cellular receptors is essential for the growth and sur...  Read full blog post.

TrkB: Docking for Neurotrophins and Beyond.
Tropomyosin receptor kinase B (TrkB) is a member of the Trk receptor tyrosine kinases family consisting of TrkA, TrkB and TrkC. The sequence of these family members is highly conserved. TrK's are activated by several neurotrophins, which are small pro...  Read full blog post.

BDNF Antibodies Aid Research on Alzheimer's Therapies
Brain-derived neurotrophic factor (BDNF) is known to be important for neuronal differentiation, survival, migration and plasticity in both the developing embryo and adult synapses. The BDNF antibody is also proving to be an important tool in Alzheimer...  Read full blog post.

BDNF Antibodies and Synaptic Research
Brain-derived neurotrophic factor (BDNF) is a member of the NGF family of neurotrophins. During development it regulates the survival and differentiation of neuronal cell populations in the central and peripheral nervous system, while in adult synapse...  Read full blog post.

Showing 1-10 of 11 blog posts - Show all blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BDNF Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol BDNF
Uniprot