CDP/CUTL1 Antibody (2A10)

Images

 
Western Blot: CDP/CUTL1 Antibody (2A10) [H00001523-M01] - Analysis of CUX1 expression in transfected 293T cell line by CUTL1 monoclonal antibody (M01), clone 2A10.Lane 1: CUX1 transfected lysate(77.2 KDa).Lane 2: ...read more
Immunocytochemistry/ Immunofluorescence: CDP/CUTL1 Antibody (2A10) [H00001523-M01] - Analysis of monoclonal antibody to CUTL1 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: CDP/CUTL1 Antibody (2A10) [H00001523-M01] - Analysis of monoclonal antibody to CUTL1 on formalin-fixed paraffin-embedded human malignant lymphoma, diffuse large B tissue. Antibody ...read more
Immunohistochemistry-Paraffin: CDP/CUTL1 Antibody (2A10) [H00001523-M01] - mouse cortex - postnatal brain was stained with anti-CUTL1 antibody. Image from verified customer review.
Immunoprecipitation: CDP/CUTL1 Antibody (2A10) [H00001523-M01] - Analysis of CUX1 transfected lysate using anti-CUX1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CUX1 MaxPab rabbit polyclonal ...read more
ELISA: CDP/CUTL1 Antibody (2A10) [H00001523-M01] - Detection limit for recombinant GST tagged CUTL1 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P, IP
Clone
2A10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CDP/CUTL1 Antibody (2A10) Summary

Immunogen
CUTL1 (NP_001904.2, 521 a.a. - 620 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AENRLAQHTLQALQSELDSLRADNIKLFEKIKFLQSYPGRGSGSDDTELRYSSQYEERLDPFSSFSKRERQRKYLSLSPWDKATLSMGRLVLSNKMARTI
Specificity
CUTL1 - cut-like 1, CCAAT displacement protein (Drosophila)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CUX1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation
Application Notes
Antibody reactivity against recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.
Reviewed Applications
Read 1 Review rated 4
using
H00001523-M01 in the following applications:

Publications
Read Publications using H00001523-M01.

Reactivity Notes

Mouse reactivity reported from customer review. Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CDP/CUTL1 Antibody (2A10)

  • CASP
  • CCAAT displacement protein
  • CDP
  • CDP/Cux
  • CDPCCAAT displacement protein
  • COY1
  • cut (Drosophila)-like 1 (CCAAT displacement protein)
  • CUT
  • CUTL1
  • cut-like 1, CCAAT displacement protein (Drosophila)
  • cut-like homeobox 1
  • CUX
  • CUX1
  • FLJ31745
  • golgi integral membrane protein 6
  • GOLIM6
  • homeobox protein cut-like 1
  • Homeobox protein cux-1
  • Nbla10317
  • p100
  • p110
  • p200
  • p75
  • protein CASP
  • putative protein product of Nbla10317

Background

The protein encoded by this gene is a member of the homeodomain family of DNA binding proteins. It may regulate gene expression, morphogenesis, and differentiation and it may also play a role in the cell cycle progession. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB367
Species: Hu, Ca
Applications: WB, IHC, ICC
248-BD
Species: Hu, Mu, Rt, Ca, Eq
NB110-75039
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF175
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005034-B01P
Species: Hu
Applications: WB, ICC/IF
MAB6638
Species: Hu, Mu, Rt
Applications: WB
MAB7745
Species: Hu
Applications: WB, Simple Western, IHC
H00004354-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-87801
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83227
Species: Hu, Mu(-)
Applications: WB, IHC, IHC-P
NB100-56583
Species: Hu
Applications: WB, Flow, IHC-P
NBP1-88650
Species: Hu
Applications: WB, IHC, IHC-P
NB110-40561
Species: Hu
Applications: WB, IP
H00001523-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP

Publications for CDP/CUTL1 Antibody (H00001523-M01)(3)

Review for CDP/CUTL1 Antibody (H00001523-M01) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using H00001523-M01:
Filter by Applications
IHC-P
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Paraffin CDP/CUTL1 H00001523-M01
Enlarge
reviewed by:
Anonymous
IHC-P Mouse 10/03/2014
View

Summary

ApplicationImmunohistochemistry-Paraffin
Sample Testedmouse brain
SpeciesMouse

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CDP/CUTL1 Antibody (H00001523-M01). (Showing 1 - 1 of 1 FAQs).

  1. We are intending to do a ChIP with CUX1 (p75 isoform) and would therefore be interested in your antibody (Cat. # H00001523-M01). Has it been shown that it recognizes the p75 isoform of CUX1? (http://www.ncbi.nlm.nih.gov/protein/NP_852477.1) Are there any references or data you could send us that can confirm that this antibody would be suitable for a ChIP? Or do you have a different antibody that works for our desired application?
    • This antibody is produced by a Taiwanese company called Abnova and we distribute it for them. We do no in-house testing or development of their products. The immunogen for this antibody is present in the p75 isoform of CUX1, so it will recognize this isoform. It has successfully been used in IP, so it should work just fine in ChIP. The use of the antibody in these two applications is essentially the same, so there should be no problems.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for CDP/CUTL1 Antibody (H00001523-M01)

Discover related pathways, diseases and genes to CDP/CUTL1 Antibody (H00001523-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDP/CUTL1 Antibody (H00001523-M01)

Discover more about diseases related to CDP/CUTL1 Antibody (H00001523-M01).
 

Pathways for CDP/CUTL1 Antibody (H00001523-M01)

View related products by pathway.

PTMs for CDP/CUTL1 Antibody (H00001523-M01)

Learn more about PTMs related to CDP/CUTL1 Antibody (H00001523-M01).

Blogs on CDP/CUTL1

There are no specific blogs for CDP/CUTL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Anonymous
10/03/2014
Application: IHC-P
Species: Mouse

Bioinformatics

Gene Symbol CUX1
Entrez
OMIM
Uniprot