HCLS1 Antibody (1A8)

Images

 
Western Blot: HCLS1 Antibody (1A8) [H00003059-M02] - Analysis of HCLS1 expression in transfected 293T cell line by HCLS1 monoclonal antibody (M02), clone 1A8.Lane 1: HCLS1 transfected lysate(54 KDa).Lane 2: ...read more
Immunohistochemistry-Paraffin: HCLS1 Antibody (1A8) [H00003059-M02] - Analysis of monoclonal antibody to HCLS1 on formalin-fixed paraffin-embedded human tonsil. Antibody concentration 3 ug/ml.
Western Blot: HCLS1 Antibody (1A8) [H00003059-M02] - Analysis of HCLS1 over-expressed 293 cell line, cotransfected with HCLS1 Validated Chimera RNAi ( Cat # H00003059-R01V ) (Lane 2) or non-transfected control (Lane 1). ...read more
Western Blot: HCLS1 Antibody (1A8) [H00003059-M02] - HCLS1 monoclonal antibody (M02), clone 1A8 Analysis of HCLS1 expression in K-562.
Proximity Ligation Assay: HCLS1 Antibody (1A8) [H00003059-M02] - Analysis of protein-protein interactions between CASP3 and HCLS1. HeLa cells were stained with anti-CASP3 rabbit purified polyclonal 1:1200 and anti-HCLS1 ...read more
Sandwich ELISA: HCLS1 Antibody (1A8) [H00003059-M02] - Detection limit for recombinant GST tagged HCLS1 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, Func, IHC, KD
Clone
1A8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HCLS1 Antibody (1A8) Summary

Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
HCLS1 (AAH16758, 266 a.a. ~ 355 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QERKAVTKRSPEAPQPVIAMEEPAVPAPLPKKISSEAWPPVGTPPSSESEPVRTSREHPVPLLPIRQTLPEDNEEPPALPPRTLEGLQVE
Specificity
HCLS1 (1A8)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HCLS1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Knockdown Validated
  • Proximity Ligation Assay
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P, RNAi Validation and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HCLS1 Antibody (1A8)

  • Cortactin-like
  • CTTNL
  • HCLS1
  • hematopoietic cell-specific Lyn substrate 1hematopoietic lineage cell-specific protein
  • HS1lckBP1
  • LckBP1
  • p75

Background

Substrate of the antigen receptor-coupled tyrosine kinase. Plays a role in antigen receptor signaling forboth clonal expansion and deletion in lymphoid cells. May also be involved in the regulation of gene expression

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for HCLS1 Antibody (H00003059-M02) (0)

There are no publications for HCLS1 Antibody (H00003059-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HCLS1 Antibody (H00003059-M02) (0)

There are no reviews for HCLS1 Antibody (H00003059-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HCLS1 Antibody (H00003059-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HCLS1 Products

Research Areas for HCLS1 Antibody (H00003059-M02)

Find related products by research area.

Blogs on HCLS1

There are no specific blogs for HCLS1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HCLS1 Antibody (1A8) and receive a gift card or discount.

Bioinformatics

Gene Symbol HCLS1
Entrez
OMIM
Uniprot