ZP2 Antibody

Images

 
Western Blot: ZP2 Antibody [NBP1-86103] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: ZP2 Antibody [NBP1-86103] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZP2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PNCTYILDPEKLTLRATYDNCTRRVHGGHQMTIRVMNNSAALRHGAVMYQFFCPAMQVEETQGLSASTICQKDFMSFSLPRVFSGLADDSKGTKVQMGWSIEVGDGARAKTLTLPEAMKEGFSLLIDNHRMTFHVPFNATGVT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ZP2 Recombinant Protein Antigen (NBP1-86103PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZP2 Antibody

  • zona pellucida glycoprotein 2 (sperm receptor)
  • Zona pellucida glycoprotein 2
  • zona pellucida glycoprotein ZP2
  • Zona Pellucida Protein A
  • zona pellucida sperm-binding protein 2
  • ZP2
  • Zp-2
  • ZPA

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-30830
Species: Hu
Applications: IHC, IHC-P
NBP1-86823
Species: Hu
Applications: IHC, IHC-P
423-F8/CF
Species: Hu, Mu
355-BM/CF
Species: Hu, Mu, Rt
NBP2-14260
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
H00344018-P01
Species: Hu
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
AF3690
Species: Hu, Mu
Applications: WB, ChIP, ICC
NB100-1903
Species: Hu, Mu, Rt, Po, Ca, Ha, Pm
Applications: WB, B/N, Flow, ICC/IF, IHC-P, IP
AF3876
Species: Hu, Mu
Applications: WB, IHC
NBP1-47945
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-52149
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
3008-WN/CF
Species: Hu
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP1-86103
Species: Hu
Applications: WB, IHC, IHC-P

Publications for ZP2 Antibody (NBP1-86103) (0)

There are no publications for ZP2 Antibody (NBP1-86103).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZP2 Antibody (NBP1-86103) (0)

There are no reviews for ZP2 Antibody (NBP1-86103). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZP2 Antibody (NBP1-86103) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZP2 Products

Bioinformatics Tool for ZP2 Antibody (NBP1-86103)

Discover related pathways, diseases and genes to ZP2 Antibody (NBP1-86103). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZP2 Antibody (NBP1-86103)

Discover more about diseases related to ZP2 Antibody (NBP1-86103).
 

Pathways for ZP2 Antibody (NBP1-86103)

View related products by pathway.

PTMs for ZP2 Antibody (NBP1-86103)

Learn more about PTMs related to ZP2 Antibody (NBP1-86103).

Blogs on ZP2

There are no specific blogs for ZP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZP2
Entrez
Uniprot