ZP4 Antibody - BSA Free

Immunohistochemistry-Paraffin: ZP4 Antibody [NBP1-86823] - Staining of human ovary shows cytoplasmic positivity in oocytes.

Staining of human skeletal muscle shows no positivity in myocytes as expected.

Staining of human lymph node shows no positivity in non-germinal center cells as expected.

Staining of human liver shows no positivity in hepatocytes as expected.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ZP4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ZP4 Antibody - BSA Free (NBP1-86823) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: FAVNLNQEATSPPVLIAWDNQGLLHELQNDSDCGTWIRKGPGSSVVLEATYSSCYVTEWDSHYIMPVGVEGAGAAEHKVVTERKLLKCPMDLLARDAPDTDWCDSIPA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZP4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  ZP4 Protein (NBP1-86823PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ZP4 Antibody - BSA Free

• zinc finger and homeodomain protein 1
• zinc fingers and homeobox 1
• zinc fingers and homeoboxes 1
• zinc fingers and homeoboxes protein 1
• zinc-fingers and homeoboxes 1

Background

The zona pellucida is an extracellular matrix that surrounds the oocyte and early embryo. It is composed primarily of three or four glycoproteins with various functions during fertilization and preimplantation development. The nascent protein contains a N-terminal signal peptide sequence, a conserved ZP domain, a consensus furin cleavage site, and a C-terminal transmembrane domain. It is hypothesized that furin cleavage results in release of the mature protein from the plasma membrane for subsequent incorporation into the zona pellucida matrix. However, the requirement for furin cleavage in this process remains controversial based on mouse studies. Previously, this gene has been referred to as ZP1 or ZPB and thought to have similar functions as mouse Zp1. However, a human gene with higher similarity and chromosomal synteny to mouse Zp1 has been assigned the symbol ZP1 and this gene has been assigned the symbol ZP4. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZP4
• Entrez:
  • 57829(Human)
• Uniprot:
  • Q12836(Human)