ZP4 Antibody

Images

 
Immunohistochemistry-Paraffin: ZP4 Antibody [NBP1-86823] - Staining of human ovary shows cytoplasmic positivity in oocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZP4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FAVNLNQEATSPPVLIAWDNQGLLHELQNDSDCGTWIRKGPGSSVVLEATYSSCYVTEWDSHYIMPVGVEGAGAAEHKVVTERKLLKCPMDLLARDAPDTDWCDSIPA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZP4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ZP4 Protein (NBP1-86823PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZP4 Antibody

  • zinc finger and homeodomain protein 1
  • zinc fingers and homeobox 1
  • zinc fingers and homeoboxes 1
  • zinc fingers and homeoboxes protein 1
  • zinc-fingers and homeoboxes 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-30830
Species: Hu
Applications: IHC, IHC-P
NBP1-86103
Species: Hu
Applications: WB, IHC, IHC-P
H00344018-P01
Species: Hu
NB100-1903
Species: Hu, Mu, Rt, Po, Ca, Ha, Pm
Applications: WB, B/N, Flow, ICC/IF, IHC-P, IP
NBP2-14260
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
5096-BM
Species: Hu
NBP1-85027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76289
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, ICC
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NB100-2437
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
AF2030
Species: Hu
Applications: WB, IHC
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85409
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ZP4 Antibody (NBP1-86823) (0)

There are no publications for ZP4 Antibody (NBP1-86823).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZP4 Antibody (NBP1-86823) (0)

There are no reviews for ZP4 Antibody (NBP1-86823). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ZP4 Antibody (NBP1-86823) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZP4 Products

Bioinformatics Tool for ZP4 Antibody (NBP1-86823)

Discover related pathways, diseases and genes to ZP4 Antibody (NBP1-86823). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZP4 Antibody (NBP1-86823)

Discover more about diseases related to ZP4 Antibody (NBP1-86823).
 

Pathways for ZP4 Antibody (NBP1-86823)

View related products by pathway.

PTMs for ZP4 Antibody (NBP1-86823)

Learn more about PTMs related to ZP4 Antibody (NBP1-86823).

Blogs on ZP4

There are no specific blogs for ZP4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZP4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZP4
Entrez
Uniprot