Reactivity | Hu, Mu, RtSpecies Glossary |
Applications | WB, IHC, IHC-P |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RWFDKTLQFIVAEDGSCGLVYEHAAAEGPPIVTLLDYVIEYTKKPELVRSPMVPLPMPKKLRFNITPEIKSDIEKAKQNLSIMIQDLDITVMVFHHFGKDF |
Predicted Species | Mouse (90%), Rat (90%). Backed by our 100% Guarantee. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | CRAT |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
Control Peptide |
|
||
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Publication using NBP1-86616 | Applications | Species |
---|---|---|
Lasheras-Otero I, Feliu I, Maillo A et al. The regulators of peroxisomal acyl-carnitine shuttle CROT and CRAT promote metastasis in melanoma Journal of Investigative Dermatology 2022-09-01 [PMID: 36058299] (KD, WB, Human) Details: Supplementary figure 4 |
KD, WB | Human |
Secondary Antibodies |
Isotype Controls |
Diseases for CRAT Antibody (NBP1-86616)Discover more about diseases related to CRAT Antibody (NBP1-86616).
| Pathways for CRAT Antibody (NBP1-86616)View related products by pathway.
|
PTMs for CRAT Antibody (NBP1-86616)Learn more about PTMs related to CRAT Antibody (NBP1-86616).
| Research Areas for CRAT Antibody (NBP1-86616)Find related products by research area.
|
FANCD2 and DNA damage repair Fanconi anemia (FA) is a genetically inherited disorder that yields cytogenetic instability, hypersensitivity to DNA crosslinking compounds and defective DNA repair. A variety of genes have been identified within the FA pathway that are referred t... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | CRAT |