CRAT Antibody

Images

 
Independent Antibodies: Western Blot: CRAT Antibody [NBP1-86616] - Analysis using Anti-CRAT antibody NBP1-86616 (A) shows similar pattern to independent antibody NBP1-86615 (B).
Orthogonal Strategies: Immunohistochemistry-Paraffin: CRAT Antibody [NBP1-86616] - Analysis in human testis and lymph node tissues. Corresponding CRAT RNA-seq data are presented for the same tissues.
Western Blot: CRAT Antibody [NBP1-86616] - Analysis in human cell line TD47D.
Immunohistochemistry-Paraffin: CRAT Antibody [NBP1-86616] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: CRAT Antibody [NBP1-86616] - Staining of human lymph node shows no positivity as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CRAT Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RWFDKTLQFIVAEDGSCGLVYEHAAAEGPPIVTLLDYVIEYTKKPELVRSPMVPLPMPKKLRFNITPEIKSDIEKAKQNLSIMIQDLDITVMVFHHFGKDF
Specificity
Specificity of human CRAT antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CRAT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control
CRAT Knockout 293T Cell Lysate
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CRAT Antibody

  • Carnitine acetylase
  • Carnitine acetyltransferaseCrAT
  • carnitine O-acetyltransferase
  • CAT
  • CAT1EC 2.3.1.7
  • EC 2.3.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP2-76932
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC
NBP1-89727
Species: Hu
Applications: IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, B/N
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB110-75039
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-30052
Species: Hu, Mu, Rt, Av, Ch, GP, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl, IHC-WhMt
NB300-187
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC
NB110-61574
Species: Hu, Mu, Bv, Gt, Sh
Applications: WB
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P
NBP2-67656
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-69571
Species: Hu, Mu, Rt, Bv, Ca, Eq, Gt, GP, Rb
Applications: WB, IHC, IHC-P
NBP1-86616
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for CRAT Antibody (NBP1-86616) (0)

There are no publications for CRAT Antibody (NBP1-86616).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CRAT Antibody (NBP1-86616) (0)

There are no reviews for CRAT Antibody (NBP1-86616). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CRAT Antibody (NBP1-86616) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional CRAT Products

Bioinformatics Tool for CRAT Antibody (NBP1-86616)

Discover related pathways, diseases and genes to CRAT Antibody (NBP1-86616). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CRAT Antibody (NBP1-86616)

Discover more about diseases related to CRAT Antibody (NBP1-86616).
 

Pathways for CRAT Antibody (NBP1-86616)

View related products by pathway.

PTMs for CRAT Antibody (NBP1-86616)

Learn more about PTMs related to CRAT Antibody (NBP1-86616).
 

Research Areas for CRAT Antibody (NBP1-86616)

Find related products by research area.

Blogs on CRAT.

FANCD2 and DNA damage repair
Fanconi anemia (FA) is a genetically inherited disorder that yields cytogenetic instability, hypersensitivity to DNA crosslinking compounds and defective DNA repair. A variety of genes have been identified within the FA pathway that are referred t...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CRAT Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CRAT