Home » CRAT » CRAT Antibodies » CRAT Antibody

CRAT Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: CRAT Antibody [NBP1-86616] - Analysis in human testis and lymph node tissues. Corresponding CRAT RNA-seq data are presented for the same tissues.
Orthogonal Strategies: Immunohistochemistry-Paraffin: CRAT Antibody [NBP1-86616] - Analysis in human testis and lymph node tissues. Corresponding CRAT RNA-seq data are presented for the same tissues.
Independent Antibodies: Western Blot: CRAT Antibody [NBP1-86616] - Analysis using Anti-CRAT antibody NBP1-86616 (A) shows similar pattern to independent antibody NBP1-86615 (B).
Western Blot: CRAT Antibody [NBP1-86616] - Analysis in human cell line TD47D.
Immunohistochemistry-Paraffin: CRAT Antibody [NBP1-86616] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: CRAT Antibody [NBP1-86616] - Staining of human lymph node shows no positivity as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

      

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

CRAT Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RWFDKTLQFIVAEDGSCGLVYEHAAAEGPPIVTLLDYVIEYTKKPELVRSPMVPLPMPKKLRFNITPEIKSDIEKAKQNLSIMIQDLDITVMVFHHFGKDF
Predicted Species
Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CRAT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CRAT Protein (NBP1-86616PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CRAT Antibody

  • Carnitine acetylase
  • Carnitine acetyltransferaseCrAT
  • carnitine O-acetyltransferase
  • CAT
  • CAT1EC 2.3.1.7
  • EC 2.3.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

SOD1/Cu-Zn SOD
Antibody
NBP2-24915
Western Blot: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Human ocular fluid. Antibody at 1:1000. Western blot image submitted by a verified customer review.
Western Blot: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Bovine ocular fluid. Antibody at 1:1000. Western blot image submitted by a verified customer review.
Immunohistochemistry-Paraffin: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Analysis of Superoxide Dismutase 1 in FFPE human liver tissue using an isotype control (top) and NBP2-24915 (bottom) at 5 ug/ml.
(3 Reviews)
(9 Publications)
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Glutathione
Reductase Antibody
NBP2-76932
Western Blot: Glutathione Reductase Antibody [NBP2-76932] - Western blot analysis of GLUR on different lysates using anti-GLUR antibody at 1/2,000 dilution.Positive control:Lane1: A549 Lane2: Rat liver tissue
Immunocytochemistry/Immunofluorescence: Glutathione Reductase Antibody [NBP2-76932] - ICC staining GLUR in A549 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry: Glutathione Reductase Antibody [NBP2-76932] - Immunohistochemical analysis of paraffin-embedded rat epididymis tissue using anti-GLUR antibody. Counter stained with hematoxylin.
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Glutathione S
Transferase kappa 1 A ...
NBP2-80461
Western Blot: Glutathione S Transferase kappa 1 Antibody (JE47-38) [NBP2-80461] - Western blot analysis of GSTK1 on different lysates. Proteins were transferred to a PVDF membrane and blocked with 5% BSA in PBS for 1 hour at room temperature. The primary antibody (1:1000) was used in 5% BSA at room temperature for 2 hours. Goat Anti-Rabbit IgG - HRP Secondary Antibody at 1:5000 dilution was used for 1 hour at room temperature.Positive control:Lane 1: SK-BR-3 cell lysateLane 2: Human skin tissue lysateLane 3: Human placenta tissue lysate
Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody (JE47-38) [NBP2-80461] - Immunohistochemical analysis of paraffin-embedded human liver cancer tissue using anti-GSTK1 antibody. The section was pre-treated using heat mediated antigen retrieval with Tris-EDTA buffer (pH 8.0-8.4) for 20 minutes.The tissues were blocked in 5% BSA for 30 minutes at room temperature, washed with ddH2O and PBS, and then probed with the primary antibody (1:50) for 30 minutes at room temperature. The detection was performed using an HRP conjugated compact polymer system. DAB was used as the chromogen. Tissues were counterstained with hematoxylin and mounted with DPX.
Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody (JE47-38) [NBP2-80461] - Immunohistochemical analysis of paraffin-embedded human skin tissue using anti-GSTK1 antibody. The section was pre-treated using heat mediated antigen retrieval with Tris-EDTA buffer (pH 8.0-8.4) for 20 minutes.The tissues were blocked in 5% BSA for 30 minutes at room temperature, washed with ddH2O and PBS, and then probed with the primary antibody (1:50) for 30 minutes at room temperature. The detection was performed using an HRP conjugated compact polymer system. DAB was used as the chromogen. Tissues were counterstained with hematoxylin and mounted with DPX.
Species: Hu
Applications: Flow, IHC, IHC-P, WB
SLCO6A1 Antibody
NBP2-49118
Immunohistochemistry-Paraffin: SLCO6A1 Antibody [NBP2-49118] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: SLCO6A1 Antibody [NBP2-49118] - Staining in human testis and endometrium tissues using anti-SLCO6A1 antibody. Corresponding SLCO6A1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: SLCO6A1 Antibody [NBP2-49118] - Staining of human testis shows high expression.
Species: Hu
Applications: IHC, IHC-P
GR/NR3C1 Antibody
(BuGR2)
NB300-731
Flow Cytometry: GR/NR3C1 Antibody (BuGR2) [NB300-731] - An intracellular stain was performed on Jurkat cells with GR/NR3C1 (BuGR2) antibody NB300-731PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Phycoerthrin.
Flow Cytometry: GR/NR3C1 Antibody (BuGR2) [NB300-731] - Using the Alexa Fluor 647 direct conjugate An intracellular stain was performed on HeLa cells with GR/NR3C1 (BuGR2) antibody NB300-731AF647 (blue) and a matched isotype control NB600-986AF647 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Immunocytochemistry/Immunofluorescence: GR/NR3C1 Antibody (BuGR2) [NB300-731] - Analysis of Glucocorticoid Receptor using Glucocorticoid Receptor Monoclonal Antibody (BuGR2) shows staining in A549 Cells. Glucocorticoid Receptor (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with an antibody recognizing Glucocorticoid Receptor at a dilution of 1:100 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
(3 Reviews)
(12 Publications)
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB

Acetylcholinesterase/A
NB100-1519
Western Blot: Acetylcholinesterase/ACHE Antibody [NB100-1519] - Staining of HepG2 (A) and Daudi cell lysates with antibody at 1 ug/mL (B) and HeLa (C) and Jurkat (D) cell lysates with antibody at 0.3 ug/mL (35 ug protein in RIPA buffer). Detected by chemiluminescence.
Immunocytochemistry/Immunofluorescence: Acetylcholinesterase/ACHE Antibody [NB100-1519] - Immunofluorescence analysis of paraformaldehyde fixed U2OS cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (4 ug/mL), showing cytoplasmic and nuclear/Vesicle staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (4 ug/mL).
Flow Cytometry: Acetylcholinesterase/ACHE Antibody [NB100-1519] - Flow cytometric analysis of paraformaldehyde fixed HeLa cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-FrFl, PEP-ELISA, WB
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(36 Reviews)
(683 Publications)
Species: Hu
Applications: BA
c-jun [p Ser63]
Antibody (SY0297)
NBP2-67471
Immunocytochemistry/Immunofluorescence: c-jun [p Ser63] Antibody (SY0297) [NBP2-67471] - Staining Phospho-c-Jun(S63) in A549 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: c-jun [p Ser63] Antibody (SY0297) [NBP2-67471] - Staining Phospho-c-Jun(S63) in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: c-jun [p Ser63] Antibody (SY0297) [NBP2-67471] - Analysis of paraffin-embedded human breast carcinoma tissue using anti-Phospho-c-Jun(S63) antibody. Counter stained with hematoxylin.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
c-Fos Antibody
(2H2)
NBP2-50037
Knockout Validated: c-Fos Antibody (2H2) [NBP2-50037] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and c-Fox knockout (KO) HeLa cell line. PVDF membrane was probed with 1:1000 of Mouse Anti-Human c-Fox Monoclonal Antibody (Catalog # NBP2-50037) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog #HAF018). Specific band was detected for c-Fox at approximately 52 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Immunocytochemistry/Immunofluorescence: c-Fos Antibody (2H2) [NBP2-50037] - Section of rat hippocampus stained with mouse monoclonal antibody to c-FOS NBP2-50037 in red and counterstained with rabbit polyclonal antibody to FOX3/NeuN. DAPI reveals nuclei of neurons and glia in blue. The hippocampal neurons stain green for FOX3/NeuN and a few also are expressing c-FOS, and so appear orange. These cells were spontaneously active at the time the animal was sacrificed.
Immunocytochemistry/Immunofluorescence: c-Fos Antibody (2H2) [NBP2-50037] - Left: NBP2-50037 staining (green) in HeLa cells, which were treated with serum-starvation for 36 hrs, followed by 2 hrs 20% FBS stimulation (bottom), or PBS treatment (top). Green c-Fos staining only localizes in the nuclei of stimulated cells, but not in un-stimulated cells. Cells are counter-stained with chicken pAb against Vimentin (NB300-223, red). Blue shows DAPI staining of nucleus. Middle: Mouse brain section (45 uM; fixed by transcardial perfusion with 4% PFA) labeled with NBP2-50037 using a standard HRP-DAB staining technique. Cells expressing c-Fos show dark color in nucleus. Right: Mouse cortical section labeled with NBP2-50037 (red) and rabbit polyclonal anti-NeuN (NBP1-92716, green) using IF confocal. Neurons positive for c-Fos and RBFOX3/NeuN appear to be yellow. Inset shows an enlarged image of NBP2-50037 staining. Nuclei are labeled with Dapi (blue).
(1 Review)
(9 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Choline
Acetyltransferase/ChA
NBP1-30052
Immunohistochemistry-Paraffin: Choline Acetyltransferase/ChAT Antibody [NBP1-30052] - Rat brainstem showing specific labeling using the anti-ChAT antibody. Image courtesy of Dr. Robert Sloviter, University of Arizona.
Immunocytochemistry/Immunofluorescence: Choline Acetyltransferase/ChAT Antibody [NBP1-30052] - Immunostaining of anterior horn of lumbar spinal cord for Choline Acetyltransferase/ChAT (in green) and p62 (in red) at 130 days. Scale bar, 10 um. Image collected and cropped by CiteAb from the following publication (http://embomolmed.embopress.org/lookup/doi/10.15252/emmm.201808888), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: Choline Acetyltransferase/ChAT Antibody [NBP1-30052] - Representative images of lumbar spinal cord sections at 130 days immunostained with Choline Acetyltransferase/ChAT. Scale bar, 200 um. Image collected and cropped by CiteAb from the following publication (http://embomolmed.embopress.org/lookup/doi/10.15252/emmm.201808888), licensed under a CC-BY licence.
(17 Publications)
Species: Ch, Gp, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, WB
Substance P
Antibody (266815)
MAB4375
Substance P was detected in immersion fixed paraffin-embedded sections of human spinal cord using 8 µg/mL Human/Mouse/Rat Substance P Monoclonal Antibody (Catalog # MAB4375) overnight at 4 °C. Tissue was stained with the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Specific labeling was localized to the spinal cord dorsal horn. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(3 Reviews)
(5 Publications)
Species: Hu, Mu, Rt
Applications: IHC
LIGHT/TNFSF14
[Unconjugated]
664-LI/CF
1 µg/lane of Recombinant Human LIGHT/TNFSF14 (Catalog # 664-LI/CF) was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a band at 25 kDa.
Recombinant Human LIGHT/TNFSF14 (Catalog # 664-LI/CF) stimulates cell proliferation in HUVEC human umbilical vein endothelial cells. The ED50 is 1-4 ng/mL.
(17 Publications)
Species: Hu
Applications: BA
Lactoperoxidase
Antibody
NB110-61574
Western Blot: Lactoperoxidase Antibody [NB110-61574] - Detection of LPO in MDA-MB231 cell lysate
Species: Bv, Gt, Hu, Mu, Sh
Applications: WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Insulin was detected in immersion fixed beta TC‑6 mouse beta cell insulinoma cell line using Human/Mouse/Bovine Insulin Monoclonal Antibody (Catalog # MAB1417) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rat IgG Secondary Antibody (red; Catalog # NL013) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(11 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
hnRNP C1 + C2
Antibody (SN0652)
NBP2-67656
Flow Cytometry: hnRNP C1 + C2 Antibody (SN0652) [NBP2-67656] - Analysis of Hela cells with hnRNP C1+C2 antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody
Immunocytochemistry/Immunofluorescence: hnRNP C1 + C2 Antibody (SN0652) [NBP2-67656] - Staining hnRNP C1+C2 in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: hnRNP C1 + C2 Antibody (SN0652) [NBP2-67656] - Staining hnRNP C1+C2 in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu, Mu, Rt, Ze
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western lane view shows lysates of human serum, loaded at 1:25000. A specific band was detected for Albumin at approximately 64 kDa (as indicated) using 1 µg/mL of Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) . This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Albumin was detected in immersion fixed BG01V human embryonic stem cells differentiated to hepatocytes using Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. Cells were co-stained using Sheep Anti-Human CEBP alpha (Catalog # AF7094) and NorthernLights™ 493-conjugated Anti-Sheep IgG Secondary Antibody (green, Catalog # NL012). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Albumin was detected in immersion fixed paraffin-embedded sections of human liver using Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) at 0.1 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Mouse IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC001). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm and plasma membrane. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
(5 Reviews)
(27 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
PMEL17/SILV
Antibody (OTI10E5)
NBP1-47974
Western Blot: PMEL17/SILV Antibody (10E5) [NBP1-47974] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY PMEL17/SILV(Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-PMEL17/SILV.
Immunohistochemistry-Paraffin: PMEL17/SILV Antibody (10E5) [NBP1-47974] - Staining of paraffin-embedded Adenocarcinoma of colon tissue using anti-PMEL17/SILV mouse monoclonal antibody.
Immunohistochemistry-Paraffin: PMEL17/SILV Antibody (10E5) [NBP1-47974] - Staining of paraffin-embedded breast tissue using anti-PMEL17/SILV mouse monoclonal antibody.
(1 Review)
Species: Ca, Hu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
CRAT Antibody
NBP1-86616
CRAT Antibody
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for CRAT Antibody (NBP1-86616) (0)

There are no publications for CRAT Antibody (NBP1-86616).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CRAT Antibody (NBP1-86616) (0)

There are no reviews for CRAT Antibody (NBP1-86616). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CRAT Antibody (NBP1-86616) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional CRAT Products

Bioinformatics Tool for CRAT Antibody (NBP1-86616)

Discover related pathways, diseases and genes to CRAT Antibody (NBP1-86616). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CRAT Antibody (NBP1-86616)

Discover more about diseases related to CRAT Antibody (NBP1-86616).
 

Pathways for CRAT Antibody (NBP1-86616)

View related products by pathway.

PTMs for CRAT Antibody (NBP1-86616)

Learn more about PTMs related to CRAT Antibody (NBP1-86616).
 

Research Areas for CRAT Antibody (NBP1-86616)

Find related products by research area.

Blogs on CRAT.

Check out the latest blog posts on CRAT.
FANCD2 and DNA damage repair
Fanconi anemia (FA) is a genetically inherited disorder that yields cytogenetic instability, hypersensitivity to DNA crosslinking compounds and defective DNA repair. A variety of genes have been identified within the FA pathway that are referred t...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CRAT Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol CRAT