ZP3 Antibody

Images

 
Immunohistochemistry-Paraffin: ZP3 Antibody [NBP2-30830] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: ZP3 Antibody [NBP2-30830] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Immunohistochemistry-Paraffin: ZP3 Antibody [NBP2-30830] - Staining of human ovary shows strong membranous and cytoplasmic positivity in oocyte.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZP3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: QPLWLLQGGASHPETSVQPVLVECQEATLMVMVSKDLFGTGKLIRAADLTLGPEACEPLVSMDTEDVVRFEVGLHECGNSMQVTD
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZP3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID: 30683144).
Control Peptide
ZP3 Protein (NBP2-30830PEP)
Publications
Read Publication using
NBP2-30830 in the following applications:

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 30683144).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZP3 Antibody

  • zona pellucida glycoprotein 3 (sperm receptor)

Background

The zona pellucida is an extracellular matrix that surrounds the oocyte and early embryo. It is composed primarily of three or four glycoproteins with various functions during fertilization and preimplantation development. The protein encoded by this gene is a structural component of the zona pellucida and functions in primary binding and induction of the sperm acrosome reaction. The nascent protein contains a N-terminal signal peptide sequence, a conserved ZP domain, a C-terminal consensus furin cleavage site, and a transmembrane domain. It is hypothesized that furin cleavage results in release of the mature protein from the plasma membrane for subsequent incorporation into the zona pellucida matrix. However, the requirement for furin cleavage in this process remains controversial based on mouse studies. A variation in the last exon of this gene has previously served as the basis for an additional ZP3 locus; however, sequence and literature review reveals that there is only one full-length ZP3 locus in the human genome. Another locus encoding a bipartite transcript designated POMZP3 contains a duplication of the last four exons of ZP3, including the above described variation, and maps closely to this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-62315
Species: Hu
Applications: WB
NBP1-86103
Species: Hu
Applications: IHC, IHC-P
NBP2-38530
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89146
Species: Hu
Applications: ICC/IF, IHC, IHC-P
DY262
Species: Hu
Applications: ELISA
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
739-G9/CF
Species: Mu
Applications: BA
NBP2-14260
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-88820
Species: Mu
Applications: WB
1503-SE
Species: Hu
Applications: EnzAct
NBP1-54805
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-76939
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP1-32870
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
2805-MF
Species: Mu
Applications: Bind
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP2-30830
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for ZP3 Antibody (NBP2-30830)(1)

We have publications tested in 1 confirmed species: Rat.

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
Rat
(1)
All Species

Reviews for ZP3 Antibody (NBP2-30830) (0)

There are no reviews for ZP3 Antibody (NBP2-30830). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ZP3 Antibody (NBP2-30830) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZP3 Products

Bioinformatics Tool for ZP3 Antibody (NBP2-30830)

Discover related pathways, diseases and genes to ZP3 Antibody (NBP2-30830). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZP3 Antibody (NBP2-30830)

Discover more about diseases related to ZP3 Antibody (NBP2-30830).
 

Pathways for ZP3 Antibody (NBP2-30830)

View related products by pathway.

PTMs for ZP3 Antibody (NBP2-30830)

Learn more about PTMs related to ZP3 Antibody (NBP2-30830).

Blogs on ZP3

There are no specific blogs for ZP3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZP3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZP3
Uniprot