FIGLA Antibody

Western Blot: FIGLA Antibody [NBP2-88820] - Host: Rabbit. Target Name: Figla. Sample Type: Mouse Spleen lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Concentration: 0.5 mg/ml

FIGLA Antibody Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse FIGLA. Peptide sequence: SSTRELLGNATQPTSCASGLKKEEEGPWAYAGHSEPLYSYHQSTVPETRS The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FIGLA
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for FIGLA Antibody

• BHLHC8
• Class C basic helix-loop-helix protein 8
• factor in the germline alpha
• FIGALPHA
• folliculogenesis specific basic helix-loop-helix
• Folliculogenesis-specific basic helix-loop-helix protein
• POF6
• Transcription factor FIGa

Background

The FIGLA gene encodes a protein that functions in postnatal oocyte-specific gene expression. The protein is a basichelix-loop-helix transcription factor that regulates multiple oocyte-specific genes, including genes involved infolliculogenesis and those that

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FIGLA Antibody (NBP2-88820)(1)

Publication using NBP2-88820

• Li MH, Wang JJ, Feng YQ et al. H3K4me3 as a target of di(2-ethylhexyl) phthalate (DEHP) impairing primordial follicle assembly Chemosphere 2022-10-08 [PMID: 36220427] (WB, Mouse)

Bioinformatics

• Gene Symbol: FIGLA