Acrosin Antibody


Immunohistochemistry-Paraffin: Acrosin Antibody [NBP2-14260] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: Acrosin Antibody [NBP2-14260] - Staining of human prostate shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Acrosin Antibody [NBP2-14260] - Staining in human testis and prostate tissues using anti-ACR antibody. Corresponding ACR RNA-seq data are presented for the more

Product Details

Reactivity Hu, Rt, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

Acrosin Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: LMEARVDLIDLDLCNSTQWYNGRVQPTNVCAGYPVGKIDTCQ
Specificity of human, rat Acrosin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500-1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID 27430551).
Control Peptide
Acrosin Protein (NBP2-14260PEP)
Read Publications using
NBP2-14260 in the following applications:

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 27430551).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Acrosin Antibody

  • acrosin
  • ACRS
  • preproacrosin
  • proacrosin


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Pm
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Acrosin Antibody (NBP2-14260)(2)

We have publications tested in 1 confirmed species: Rat.

We have publications tested in 2 applications: ICC/IF, IHC.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for Acrosin Antibody (NBP2-14260) (0)

There are no reviews for Acrosin Antibody (NBP2-14260). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Acrosin Antibody (NBP2-14260) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for Acrosin Antibody (NBP2-14260)

Discover related pathways, diseases and genes to Acrosin Antibody (NBP2-14260). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Acrosin Antibody (NBP2-14260)

Discover more about diseases related to Acrosin Antibody (NBP2-14260).

Pathways for Acrosin Antibody (NBP2-14260)

View related products by pathway.

PTMs for Acrosin Antibody (NBP2-14260)

Learn more about PTMs related to Acrosin Antibody (NBP2-14260).

Research Areas for Acrosin Antibody (NBP2-14260)

Find related products by research area.

Blogs on Acrosin

There are no specific blogs for Acrosin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Acrosin Antibody and receive a gift card or discount.


Gene Symbol ACR