Acrosin Antibody

Images

 
Immunohistochemistry-Paraffin: Acrosin Antibody [NBP2-14260] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: Acrosin Antibody [NBP2-14260] - Staining of human prostate shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Acrosin Antibody [NBP2-14260] - Staining in human testis and prostate tissues using anti-ACR antibody. Corresponding ACR RNA-seq data are presented for the ...read more

Product Details

Summary
Reactivity Hu, Rt, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Acrosin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LMEARVDLIDLDLCNSTQWYNGRVQPTNVCAGYPVGKIDTCQ
Specificity
Specificity of human, rat Acrosin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACR
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500-1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID 27430551).
Control Peptide
Acrosin Protein (NBP2-14260PEP)
Publications
Read Publications using
NBP2-14260 in the following applications:

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 27430551).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Acrosin Antibody

  • acrosin
  • ACRS
  • preproacrosin
  • proacrosin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF5739
Species: Hu, Mu, Rt
Applications: WB
NB300-560
Species: Hu, Mu, Rt, Av, Bv, Pm
Applications: WB, IHC, IHC-Fr, IHC-P, IF
7270-IL/CF
Species: Hu
NBP2-57362
Species: Hu
Applications: WB, ICC/IF
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13371
Species: Hu
Applications: IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
7268-CT
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-38530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14260
Species: Hu, Rt, Mu
Applications: ICC/IF, IHC, IHC-P

Publications for Acrosin Antibody (NBP2-14260)(2)

We have publications tested in 1 confirmed species: Rat.

We have publications tested in 2 applications: ICC/IF, IHC.


Filter By Application
ICC/IF
(1)
IHC
(1)
All Applications
Filter By Species
Rat
(1)
All Species

Reviews for Acrosin Antibody (NBP2-14260) (0)

There are no reviews for Acrosin Antibody (NBP2-14260). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Acrosin Antibody (NBP2-14260) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Acrosin Antibody (NBP2-14260)

Discover related pathways, diseases and genes to Acrosin Antibody (NBP2-14260). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Acrosin Antibody (NBP2-14260)

Discover more about diseases related to Acrosin Antibody (NBP2-14260).
 

Pathways for Acrosin Antibody (NBP2-14260)

View related products by pathway.

PTMs for Acrosin Antibody (NBP2-14260)

Learn more about PTMs related to Acrosin Antibody (NBP2-14260).
 

Research Areas for Acrosin Antibody (NBP2-14260)

Find related products by research area.

Blogs on Acrosin

There are no specific blogs for Acrosin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Acrosin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACR
Entrez
Uniprot