Orthogonal Strategies: Analysis in human testis and liver tissues using NBP2-14260 antibody. Corresponding ACR RNA-seq data are presented for the same tissues.
Staining of human testis show strong extracellular space and nuclear positivity in subset of cells in seminiferous ducts.
Staining of human liver shows no positivity in hepatocytes as expected.
Staining of human cerebral cortex shows no positivity in neurons as expected.
Staining of human lymph node shows no positivity in germinal center cells as expected.
The distribution and expression of acrosomal associated proteins in AY078 and control individual. (A–C) Immunofluorescence staining assays wereperformed on the sperm of AY078 and normal subject using anti-ACTL7A(red ...read more
The distribution and expression of acrosomal associated proteins in AY078 and control individual. (A–C) Immunofluorescence staining assays wereperformed on the sperm of AY078 and normal subject using anti-ACTL7A(red ...read more
Novus Biologicals Rabbit Acrosin Antibody - BSA Free (NBP2-14260) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-Acrosin Antibody: Cited in 13 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LMEARVDLIDLDLCNSTQWYNGRVQPTNVCAGYPVGKIDTCQ
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACR
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Rat reactivity reported in scientific literature (PMID: 27430551). Use in Mouse reported in scientific literature (PMID:32923619).
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for Acrosin Antibody - BSA Free
acrosin
ACRS
preproacrosin
proacrosin
Background
Acrosin is the major proteinase present in the acrosome of mature spermatozoa. It is a typical serine proteinase with trypsin-like specificity. It is stored in the acrosome in its precursor form, proacrosin. The active enzyme functions in the lysis of the zona pellucida, thus facilitating penetration of the sperm through the innermost glycoprotein layers of the ovum. The mRNA for proacrosin is synthesized only in the postmeiotic stages of spermatogenesis. In humans proacrosin first appears in the haploid spermatids.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our Acrosin Antibody - BSA Free and receive a gift card or discount.