Acrosin Antibody

Analysis in human testis and liver tissues using NBP2-14260 antibody. Corresponding ACR RNA-seq data are presented for the same tissues.

Staining of human testis show strong extracellular space and nuclear positivity in subset of cells in seminiferous ducts.

Staining of human liver shows no positivity in hepatocytes as expected.

Staining of human cerebral cortex shows no positivity in neurons as expected.

Staining of human lymph node shows no positivity in germinal center cells as expected.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Acrosin Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LMEARVDLIDLDLCNSTQWYNGRVQPTNVCAGYPVGKIDTCQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ACR
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in ICC/IF reported in scientific literature (PMID 27430551).
• Control Peptide:

  Acrosin Recombinant Protein Antigen (NBP2-14260PEP)

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 27430551). Use in Mouse reported in scientific literature (PMID:32923619).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Acrosin Antibody

• acrosin
• ACRS
• preproacrosin
• proacrosin

Background

Acrosin is the major proteinase present in the acrosome of mature spermatozoa. It is a typical serine proteinase with trypsin-like specificity. It is stored in the acrosome in its precursor form, proacrosin. The active enzyme functions in the lysis of the zona pellucida, thus facilitating penetration of the sperm through the innermost glycoprotein layers of the ovum. The mRNA for proacrosin is synthesized only in the postmeiotic stages of spermatogenesis. In humans proacrosin first appears in the haploid spermatids.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Acrosin Antibody (NBP2-14260)(7)

Publications using NBP2-14260

• Ma Y, Chen J, Li H et al. Immature rat testis sustained long-term development using an integrative model Biological research 2022-10-04 [PMID: 36195947] (IF/IHC, Rat)
• Yang TY, Chen Y, Chen GW et al. Sperm-specific protein ACTL7A as a biomarker for fertilization outcomes of assisted reproductive technology Asian journal of andrology 2022-02-18 [PMID: 35229759] (WB, Human)
• Zhao Q, Huang JF, Cheng Y Et al. Polyamine metabolism links gut microbiota and testicular dysfunction Microbiome 2021-11-11 [PMID: 34758869] (IF/IHC, Mouse)
• Nakamura N, Sloper DT Comparison of germ cell differentiation of rat testis fragments cultured in knockout serum replacement versus Albumax I Birth defects research 2020-12-21 [PMID: 33348473]
• Xin A, Qu R, Chen G et al. Disruption in ACTL7A causes acrosomal ultrastructural defects in human and mouse sperm as a novel male factor inducing early embryonic arrest Sci. Adv. 2020-08-01 [PMID: 32923619] (ICC/IF, Human, Mouse)
• Nakamura N, Merry GE, Inselman AL et al. Evaluation of Culture Time and Media in an In Vitro Testis Organ Culture System. Birth Defects Res. 2017-04-17 [PMID: 28398669]
• Reda A, Hou M, Winton TR et al. In vitro differentiation of rat spermatogonia into round spermatids in tissue culture. Mol. Hum. Reprod. 2016-07-18 [PMID: 27430551] (IF/IHC, ICC/IF, Rat)

Bioinformatics

• Gene Symbol: ACR
• Entrez:
  • 49(Human)
• Uniprot:
  • P10323(Human)