Acrosin Antibody - BSA Free

Images

 
Orthogonal Strategies: Analysis in human testis and liver tissues using NBP2-14260 antibody. Corresponding ACR RNA-seq data are presented for the same tissues.
Staining of human testis show strong extracellular space and nuclear positivity in subset of cells in seminiferous ducts.
Staining of human liver shows no positivity in hepatocytes as expected.
Staining of human cerebral cortex shows no positivity in neurons as expected.
Staining of human lymph node shows no positivity in germinal center cells as expected.
The distribution and expression of acrosomal associated proteins in AY078 and control individual. (A–C) Immunofluorescence staining assays wereperformed on the sperm of AY078 and normal subject using anti-ACTL7A(red ...read more
The distribution and expression of acrosomal associated proteins in AY078 and control individual. (A–C) Immunofluorescence staining assays wereperformed on the sperm of AY078 and normal subject using anti-ACTL7A(red ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Validated by:
       

Orthogonal Strategies

 

Order Details

View Available Formulations
Catalog# & Formulation Size Price

Acrosin Antibody - BSA Free Summary

Description
Novus Biologicals Rabbit Acrosin Antibody - BSA Free (NBP2-14260) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-Acrosin Antibody: Cited in 13 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LMEARVDLIDLDLCNSTQWYNGRVQPTNVCAGYPVGKIDTCQ
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACR
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence Reported in scientific literature (PMID 27430551)
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Acrosin Recombinant Protein Antigen (NBP2-14260PEP)
Publications
Read Publications using
NBP2-14260 in the following applications:

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 27430551). Use in Mouse reported in scientific literature (PMID:32923619).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Acrosin Antibody - BSA Free

  • acrosin
  • ACRS
  • preproacrosin
  • proacrosin

Background

Acrosin is the major proteinase present in the acrosome of mature spermatozoa. It is a typical serine proteinase with trypsin-like specificity. It is stored in the acrosome in its precursor form, proacrosin. The active enzyme functions in the lysis of the zona pellucida, thus facilitating penetration of the sperm through the innermost glycoprotein layers of the ovum. The mRNA for proacrosin is synthesized only in the postmeiotic stages of spermatogenesis. In humans proacrosin first appears in the haploid spermatids.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
DY1707
Species: Hu
Applications: ELISA
AF5739
Species: Hu, Mu, Rt
Applications: WB
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr,  IHC-P, WB
M6000B
Species: Mu
Applications: ELISA
NBP2-57362
Species: Hu
Applications: ICC/IF, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
AF1513
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
NBP2-20383
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-13371
Species: Hu
Applications: IHC,  IHC-P
NBP2-02623
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
7268-CT
Species: Hu
Applications: BA
NBP1-89146
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
202-IL
Species: Hu
Applications: BA
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC,  IHC-P, WB
AF262
Species: Hu
Applications: ICC, IHC, Neut, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-38530
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-14260
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC

Publications for Acrosin Antibody (NBP2-14260)(14)

We have publications tested in 3 confirmed species: Human, Mouse, Rat.

We have publications tested in 5 applications: ICC/IF, IF/IHC, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, WB.


Filter By Application
ICC/IF
(3)
IF/IHC
(3)
Immunocytochemistry/ Immunofluorescence
(2)
Immunohistochemistry
(2)
WB
(2)
All Applications
Filter By Species
Human
(3)
Mouse
(2)
Rat
(4)
All Species
Showing Publications 1 - 10 of 14. Show All 14 Publications.
Publications using NBP2-14260 Applications Species
Jiaming S, Xie G, Xinlong W et al. Erucic acid impairs male fertility by suppressing retinoic acid synthesis in sertoli cells. Ecotoxicology and environmental safety 2025-08-31 [PMID: 40889457]
Shao ZM, Zhu YT, Gu M et Al. Novel variants in DNAH6 cause male infertility associated with multiple morphological abnormalities of the sperm flagella (MMAF) and ICSI outcomes Asian J Androl 2024-01-01 [PMID: 37594300]
Hua R, Xue R, Liu Y et al. ACROSIN deficiency causes total fertilization failure in humans by preventing the sperm from penetrating the zona pellucida Human reproduction (Oxford, England) 2023-06-01 [PMID: 37004249]
Yu H, Shi X, Shao Z et al. Novel HYDIN variants associated with male infertility in two Chinese families Frontiers in endocrinology 2023-01-18 [PMID: 36742411] (WB, ICC/IF, Human) WB, ICC/IF Human
Ma Y, Chen J, Li H et al. Immature rat testis sustained long-term development using an integrative model Biological research 2022-10-04 [PMID: 36195947] (IF/IHC, Rat) IF/IHC Rat
Tian-Ying Yang, Ying Chen, Guo-Wu Chen, Yi-Si Sun, Zhi-Chao Li, Xiao-Rong Shen, Yi-Ni Zhang, Wen He, Dan Zhou, Hui-Juan Shi, Ai-Jie Xin, Xiao-Xi Sun Sperm-specific protein ACTL7A as a biomarker for fertilization outcomes of assisted reproductive technology Asian Journal of Andrology 2022-01-01 [PMID: 35532568]
Yang TY, Chen Y, Chen GW et al. Sperm-specific protein ACTL7A as a biomarker for fertilization outcomes of assisted reproductive technology Asian journal of andrology 2022-02-18 [PMID: 35229759] (WB, Human) WB Human
Zhao Q, Huang JF, Cheng Y Et al. Polyamine metabolism links gut microbiota and testicular dysfunction Microbiome 2021-11-11 [PMID: 34758869] (IF/IHC, Mouse) IF/IHC Mouse
Sawaied A, Arazi E, AbuElhija A et al. The Presence of Colony-Stimulating Factor-1 and Its Receptor in Different Cells of the Testis; It Involved in the Development of Spermatogenesis In Vitro International Journal of Molecular Sciences 2021-02-26 [PMID: 33652607] (Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Rat) Immunohistochemistry, Immunocytochemistry/ Immunofluorescence Rat
Nakamura N, Sloper DT Comparison of germ cell differentiation of rat testis fragments cultured in knockout serum replacement versus Albumax I Birth defects research 2020-12-21 [PMID: 33348473]
Show All 14 Publications.

Reviews for Acrosin Antibody (NBP2-14260) (0)

There are no reviews for Acrosin Antibody (NBP2-14260). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Acrosin Antibody (NBP2-14260) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Acrosin Products

Research Areas for Acrosin Antibody (NBP2-14260)

Find related products by research area.

Blogs on Acrosin

There are no specific blogs for Acrosin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Acrosin Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol ACR
Entrez
Uniprot