| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LPGCQICQQLVRCFCGRLVKQHACFTASLAMKYSDVKLGDHFNQAIEEWSVEKHTEQSPTDAYGVINFQGGSHSYR |
| Predicted Species | Mouse (99%), Rat (97%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TRPM7 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for TRPM7 Antibody (NBP3-21259)Find related products by research area.
|
|
Winter is coming, and TRPM8 welcomes the cold! TRPM8, or transient receptor potential melastatin 8, is a nonselective cation channel that is activated by cold environments and menthol-like cooling compounds. While TRPM8 is best known for its location in peripheral nerve endings, it has functio... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TRPM7 |