Novus Biologicals products are now on bio-techne.com

TRPM1 Antibody

Images

 
Immunohistochemistry-Paraffin: TRPM1 Antibody [NBP2-58415] - Staining of human tonsil shows no positivity in non-germinal center cells.
Immunohistochemistry-Paraffin: TRPM1 Antibody [NBP2-58415] - Staining of human retina shows strong cytoplasmic positivity in inner nuclear layer and outer plexiform layer.
Immunohistochemistry-Paraffin: TRPM1 Antibody [NBP2-58415] - Staining of human duodenum shows no positivity in glandular cells.
Immunohistochemistry-Paraffin: TRPM1 Antibody [NBP2-58415] - Staining of human placenta shows no positivity in trophoblastic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TRPM1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: CEATYLLRQSSINSADGYSLYRYHFNGEELLFEDTSLSTSPGTGVRKKTCSFRIKEEKDVKTHLVPECQNSLHLSLGTSTSATPDGSHLAVDDLKNAEESKLGPDIGISKEDD
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRPM1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TRPM1 Recombinant Protein Antigen (NBP2-58415PEP)
Publications
Read Publication using NBP2-58415.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for TRPM1 Antibody

  • CSNB1C
  • Long transient receptor potential channel 1
  • LTrpC1
  • LTRPC1transient receptor potential cation channel subfamily M member 1
  • melastatin 1
  • melastatin-1
  • MLSN
  • MLSN1transient receptor potential melastatin family
  • transient receptor potential cation channel, subfamily M, member 1

Background

TRPM1 is encoded by this gene is similar to the transient receptor potential (TRP) calcium channel family members. The expression of this protein is inversely correlated with melanoma aggressiveness, suggesting that it suppresses melanoma metastasis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88370
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-49671
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-189
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
NB110-81601
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-97311
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-12906
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, MiAr, WB
NBP1-48036
Species: Ca, Hu, Pm, Pm
Applications: IHC, IHC-P, WB
AF2747
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
NBP2-88493
Species: Hu
Applications: IHC, IHC-P, WB
NB100-98864
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-71774
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
AF5769
Species: Hu
Applications: IHC, WB
NB100-98844
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP2-32372
Species: Hu, Rt
Applications: IHC, IHC-P
664-LI
Species: Hu
Applications: BA
NBP2-94226
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NB110-74960
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-58415
Species: Hu
Applications: IHC

Publications for TRPM1 Antibody (NBP2-58415)(1)

Reviews for TRPM1 Antibody (NBP2-58415) (0)

There are no reviews for TRPM1 Antibody (NBP2-58415). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TRPM1 Antibody (NBP2-58415) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TRPM1 Products

Research Areas for TRPM1 Antibody (NBP2-58415)

Find related products by research area.

Blogs on TRPM1.

Winter is coming, and TRPM8 welcomes the cold!
TRPM8, or transient receptor potential melastatin 8, is a nonselective cation channel that is activated by cold environments and menthol-like cooling compounds.  While TRPM8 is best known for its location in peripheral nerve endings, it has functio...  Read full blog post.

mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRPM1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRPM1