| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit SLC41A1 Antibody - BSA Free (NBP1-82652) is a polyclonal antibody validated for use in IHC and WB. Anti-SLC41A1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QASRISTFLHMNGMPGENSEQAPRRCPSPCTTFFSPDVNSRSAR |
| Predicted Species | Mouse (95%), Rat (95%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SLC41A1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Publications using NBP1-82652 | Applications | Species |
|---|---|---|
| Huang L, Lin R, Zhang C et al. Magnesium sulfate protects retinal dopaminergic neurons in rats with 6-OHDA-induced Parkinsons disease Research Square 2023-10-27 (Western Blot, Rat) | Western Blot | Rat |
| Liu Y, Song C, Zhang L et al. LPS-Induced Mitochondrial Damage via SLC41A1-Mediated Magnesium Ion Efflux Leads to the Pyroptosis of Dental Stem Cells. Advanced science (Weinheim, Baden-Wurttemberg, Germany) 2025-08-19 [PMID: 40831212] | ||
| Doboszewska U, Socala K, PierOg M et al. The Effects and Mechanisms of Action of TC-G 1008, GPR39 Agonist, in Animal Models of Seizures and Epilepsy Cells 2022-07-09 [PMID: 35805072] (WB, Mouse) | WB | Mouse |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SLC41A1 |