Home » Tollip » Tollip Antibodies » Tollip Antibody

Tollip Antibody

 (2 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: Tollip Antibody [NBP1-81597] - Staining of human cerebral cortex, epididymis, liver and testis using Anti-TOLLIP antibody NBP1-81597 (A) shows similar protein distribution across tissues to independent antibody NBP1-81596 (B).
Independent Antibodies: Immunohistochemistry-Paraffin: Tollip Antibody [NBP1-81597] - Staining of human cerebral cortex, epididymis, liver and testis using Anti-TOLLIP antibody NBP1-81597 (A) shows similar ...read more
Genetic Strategies: Western Blot: Tollip Antibody [NBP1-81597] - Analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1,. Remaining relative intensity is presented. Loading ...read more
Immunocytochemistry/ Immunofluorescence: Tollip Antibody [NBP1-81597] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: Tollip Antibody [NBP1-81597] - Staining of human cerebral cortex.
Western Blot: Tollip Antibody [NBP1-81597] - Analysis in human cerebral cortex tissue.
Western Blot: Tollip Antibody [NBP1-81597] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: Tollip Antibody [NBP1-81597] - Staining of human liver.
Immunohistochemistry-Paraffin: Tollip Antibody [NBP1-81597] - Staining of human testis.
Immunohistochemistry-Paraffin: Tollip Antibody [NBP1-81597] - Staining of human epididymis.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

    

Genetic Strategies

    

Order Details

100% Guarantee on every product

Tollip Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VEDKWYSLSGRQGDDKEGMINLVMSYALLPAAMVMPPQPVVLMPTVYQQGVGYVPITGMPAVCSPGMVPVALPPAAVNAQPRCSEEDLKA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TOLLIP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Tollip Protein (NBP1-81597PEP)
Publications
Read Publications using
NBP1-81597 in the following applications:

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261). Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Tollip Antibody

  • adapter protein
  • FLJ33531
  • IL-1RAcPIP
  • toll interacting protein
  • toll-interacting protein
  • Tollip

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

TLR4 Antibody
(76B357.1) - BSA Free
NB100-56566
Dual RNAscope ISH-IHC: TLR4 Antibody (76B357.1) [NB100-56566] - FFPE tissue sections of human tonsil were probed for TLR4 mRNA (ACD RNAScope Probe, ACD catalog # 311281; Fast Red chromogen, ACD catalog # 322750). Adjacent tissue section was processed for immunohistochemistry using Mouse Monoclonal (Novus Biologicals catalog # NB100-56566) at 5ug/mL with 1 hour incubation at room temperature followed by incubation with anti-mouse IgG VisUCyte HRP Polymer Antibody (Catalog # VC001) and DAB chromogen (yellow-brown). Tissue was counterstained with hematoxylin (blue). Specific staining was localized to lymphocytes.
Immunohistochemistry: TLR4 Antibody (76B357.1) [NB100-56566] - Immunofluorescent staining of TMAs. Representative tissue cores from normal (I), adenomatous polyps (II), and CRC (III and IV) are shown. Image collected and cropped by CiteAb from the following publication (http://www.jeccr.com/content/33/1/45), licensed under a CC-BY licence.
Immunohistochemistry: TLR4 Antibody (76B357.1) [NB100-56566] - Pericryptal Myofibroblasts are Responsible for Increased TLR4 Expression in a Subset of CRCs. Double-stained immunofluorescence for TLR4 (green) and vimentin (red) in normal (I), adenoma (II), and colon adenocarcinoma (III) (10x). In the stromal compartment of CRCs, immunofluorescent staining for TLR4 localized to the pericryptal myofibroblasts in a subset of samples. Image collected and cropped by CiteAb from the following publication (http://www.jeccr.com/content/33/1/45), licensed under a CC-BY licence.
(5 Reviews)
(117 Publications)
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, WB
TLR2 Antibody
(TL2.1) - BSA Free
NB100-56722
Flow (Cell Surface): TLR2 Antibody (TL2.1) [NB100-56722] - Flow (Cell Surface): - Azide Free [NB100-56726] - Analysis using the PE conjugate of NB100-56726. Staining of TLR2 on stable transfected cell line using this antibody at 1 ug/10^6 cells. Green: isotype control. Red: anti-TLR2 antibody. Image using the Azide Free form of this antibody.
Flow Cytometry: TLR2 Antibody (TL2.1) [NB100-56722] - Monitoring of TLR2 expression in normal B cells and primary MCL cells cultured for 24h in the absence/presence of CD40L, IL-4, and TLR ligands. Filled curves refer to isotypic control, empty curves to the TLR2 antibody (NB100-56722) of untreated samples. Dotted histograms represent CD40L+IL4 activated cells, dashed curves indicate CD40L+IL4 activated cells further treated with TLR ligands. Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pone.0153823) licensed under a CC-BY licence.
Block/Neutralize: TLR2 Antibody (TL2.1) [NB100-56722] - Human monocyte-derived DCs were pre-incubated wit TLR-neutralizing antibodies including TLR2 antibody (NB100-56722) for 1 h. Afterwards, DCs were infected with H. pylori G27 (MOI 5) and the levels of the costimulatory molecule CD86 and the maturation marker CD83 were analyzed by FACS on CD11c+ cells 24 h post-infection. Data are presented as mean +/- SD of five independent experiments. *p<=0.05, **p<=0.005, ***p<=0.0005. Asterisks on top of bars indicate significance relative to non-neutralized, H. pylori-primed control cells. Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pone.0104804) licensed under a CC-BY licence.
(62 Publications)
Species: Ca, Hu, Mu, Rb, Rt
Applications: B/N, DB, ELISA, Flow-CS, Flow, Func, ICC/IF, IP, In vitro, WB
IRAK1 Antibody
(3A9)
H00003654-M02
ELISA: IRAK1 Antibody (3A9) [H00003654-M02] - Detection limit for recombinant GST tagged IRAK1 is approximately 0.03ng/ml as a capture antibody.
Western Blot: IRAK1 Antibody (3A9) [H00003654-M02] - Analysis of IRAK1 expression in transfected 293T cell line by IRAK1 monoclonal antibody (M02), clone 3A9.Lane 1: IRAK1 transfected lysate(68 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: IRAK1 Antibody (3A9) [H00003654-M02] - Analysis of monoclonal antibody to IRAK1 on HeLa cell. Antibody concentration 10 ug/ml.
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, KD, WB
MyD88 Inhibitor
Peptide Set
NBP2-29328
MyD88 Inhibitor Peptide Set
(3 Reviews)
(91 Publications)
Species: Bv, Hu, Mu, Rt, Xp, Ye, Ze
Applications: BindInhib, B/N, ELISA, Flow, Func-Inh, IHC, In vitro, In vivo
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(36 Reviews)
(718 Publications)
Species: Hu
Applications: BA
NFkB p105/p50
Antibody (2J10D7) - B ...
NB100-56583
Flow Cytometry: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - An intracellular stain was performed on Jurkat cells with NFkB p105/p50 Antibody (2J10D7) NB100-56583C (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes. Both antibodies were conjugated to Dylight 650.
Flow Cytometry: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - An intracellular stain was performed on HeLa cells with NFkB p105/p50 Antibody (2J10D7) NB100-56583C (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes. Both antibodies were conjugated to Dylight 650.
Flow Cytometry: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - An intracellular stain was performed on U2-OS cells with NFkB p105/p50 [2J10D7] Antibody NB100-56583C (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to DyLight 650.
(1 Review)
(5 Publications)
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
IL-1 beta/IL-1F2
[Unconjugated]
201-LB/CF
1 μg/lane of Recombinant Human IL-1 beta /IL-1F2 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 17 kDa.
Recombinant Human IL-1 beta /IL-1F2 (Catalog # 201-LB/CF) stimulates cell proliferation of the D10.G4.1 mouse helper T cell line. The ED50 for this effect is <12 pg/mL.
(497 Publications)
Species: Hu
Applications: BA
TRAF-6 Inhibitor
Peptide Set
NBP2-26506
TRAF6 Inhibitor Peptide Set [NBP2-26506] - The TRAF6 inhibitory peptide inhibits osteoclast ifferentiation: RAW264.7 cells were plated on 24-well plates and stimulated with RANKL and M-CSF and incubated in the presence of different concentrations of control peptide (PTD) or the TRAF6. The TRAF6 at the concentration above 30 uM suppressed osteoclast differentiation.
(16 Publications)
Species: Hu, Mu, Rt
Applications: B/N, In vitro
IL-6 [HRP]
D6050
(32 Reviews)
(638 Publications)
Species: Hu
Applications: ELISA
TLR9 Antibody
(26C593.2) - BSA Free
NBP2-24729
Immunohistochemistry-Paraffin: TLR9 Antibody (26C593.2) [NBP2-24729] - Monkey retina tissue. Image from verified customer review.
Flow Cytometry: TLR9 Antibody (26C593.2) [NBP2-24729] - Expression of TLR9 protein on epithelial cells. HNEC, Detroit-562 and FaDu were stained intracellularly with PE-Ab against TLR9 (open histograms) or appropriate isotype control (shaded histograms) and analyzed by flow cytometry. Representative pictures from one out of three independent experiments are shown. Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0098239), licensed under a CC-BY licence.
Flow Cytometry: TLR9 Antibody (26C593.2) [NBP2-24729] - Analysis of colonic LP or peritoneal cavity (PerC) of normal mice were evaluated by flow cytometry. B cells were intracellularly stained with the anti-TLR9 antibody after the cell surface staining with anti-B220 and CD5 antibodies, and examined using flow cytometry. N = 3, performed twice. Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pone.0146191) licensed under a CC-BY licence.
(4 Reviews)
(150 Publications)
Species: Ca, Eq, Hu, Pm, Mu, Pm, Rt
Applications: B/N, CyTOF-ready, DB, ELISA, Flow-IC, Flow, Func, ICC/IF, IHC, IHC-P, IP, In vitro, KD, Simple Western, WB
TRIF/TICAM1
Antibody - BSA Free
NB120-13810
Knockdown Validated: TRIF/TICAM1 Antibody [NB120-13810] - siRNA was transfected at 50 nM for 48 hrs, and poly(I:C) was added at 100 ug/ml for 4 hrs before cell harvest. Negative control (NC) siRNA served as control. RNAiMAX transfection reagent was used in all the siRNA experiments. The panel shows the knockdown effect of Trif siRNA. Image collected and cropped by CiteAb from the following publication (https://onlinelibrary.wiley.com/doi/full/10.1111/jcmm.13328) licensed under a CC-BY licence.
TRIF/TICAM1 Antibody [NB120-13810] - Lysates of heart tissue were immunoprecipitated with anti-TLR3 antibodies (IP: TLR3), followed by SDS-PAGE and immunoblotting (IB) with indicated antibodies. IP with isotype IgG (IP: IgG) was performed as a control to exclude the non-specific binding of antibodies to cellular proteins. Green arrows indicate non-specific bands. The association between TLR3 and Trif, but not MyD88, was detectable in sham myocardium and was increased in infarct. Image collected and cropped by CiteAb from the following publication (https://onlinelibrary.wiley.com/doi/full/10.1111/jcmm.13328) licensed under a CC-BY licence. Anti-TLR3 antibody by WB (NB100-56571)
Immunohistochemistry-Paraffin: TRIF/TICAM1 Antibody [NB120-13810] - Analysis of a FFPE tissue section of mouse spleen using 1:200 dilution of TRIF/TICAM1 antibody. The staining was developed using HRP labeled anti-rabbit secondary antibody and DAB reagent, and nuclei of cells were counter-stained with hematoxylin.
(28 Publications)
Species: Mu, Po, Rt
Applications: IB, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
TIRAP (TLR2 and
TLR4) Inhibitor Pepti ...
NBP2-26245
TIRAP (TLR2 and TLR4) Inhibitor Peptide [NBP2-26245] - TLR2 acts through formation of heterodimer complexes with TLR1 or TLR6. HEK 293 endogenously expresses TLR1 and TLR6, so that the TLR2 reporter cell line can response to both Pam3CSK4 (TLR2/TLR1 specific ligand) and MALP-2 (TLR2/TLR6 specific ligand). The TLR2 / TLR4 inhibitor specifically inhibits TLR2/TLR1 receptor complex activity in a dose-response manner but exhibited no or little effect on TLR2/TLR6 receptor complex activity.
TIRAP (TLR2 and TLR4) Inhibitor Peptide [NBP2-26245] - The TLR4 reporter cell line responds to LPS. The TLR2 / TLR4 inhibitor specifically inhibits TLR4 activation upon LPS stimulation in a dose-response manner.
TIRAP (TLR2 and TLR4) Inhibitor Peptide [NBP2-26245] - TLR2 /4 Inhibitor suppressed the Pam3CSK4-induced TLR2/TLR1 activity [A] and the LPS-induced TLR4 activity [B] in a dose-response manner, of which IC50 values were measured as 17.2 uM and 10.47 uM, respectively.
(6 Publications)
Species: Hu, Mu
Applications: Flow, In vitro
TOM1 Antibody
NBP1-86170
Western Blot: TOM1 Antibody [NBP1-86170] - Lane 1: Marker [kDa] 207, 110, 79, 49, 32, 25, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line EFO-21. Lane 4: Human cell line A-431. Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunohistochemistry-Paraffin: TOM1 Antibody [NBP1-86170] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: TOM1 Antibody [NBP1-86170] - Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.
Species: Hu
Applications: IHC, IHC-P, WB
TLR5 Antibody
(19D759.2) - BSA Free
NBP2-24787
Immunocytochemistry/Immunofluorescence: TLR5 Antibody (19D759.2) [NBP2-24787] - Staining using in-vitro cultured fixed non-permeabilized MCF7 breast cancer cells (ATCC). EpCAM (cell membrane) staining is represented in green (FITC filter), nuclei staining is represented in blue (DAPI filter). Image from a verified customer review using the Alexa Fluor 488 conjugated format of this antibody.
Immunohistochemistry: TLR5 Antibody (19D759.2) [NBP2-24787] - TLR5 and TLR7 expression in nasopharyngeal carcinoma and in the normal epithelium. Mild positive TLR5 expression in NK-U. Strong positive TLR5 expression in KSCC. Image collected and cropped by CiteAb from the following publication (https://bmccancer.biomedcentral.com/articles/10.1186/s12885-019-5816-9), licensed under a CC-BY licence.
Flow Cytometry: TLR5 Antibody (19D759.2) - BSA Free [NBP2-24787] - Flow analysis of TLR5 in mouse MC38 cells. Image from verified customer review.
(1 Review)
(38 Publications)
Species: Ca, Hu, Mu
Applications: DB, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
SIGIRR Antibody
[Unconjugated]
AF1092
SIGIRR Antibody [Unconjugated]
(3 Publications)
Species: Mu
Applications: WB
MD-2
1787-MD/CF
MD-2
(15 Publications)
Species: Hu
Applications: Bind
TLR1 Antibody
NB100-56563
Flow Cytometry: TLR1 Antibody [NB100-56563] - Analysis using the Alexa Fluor (R) 488 conjugate of NB100-56563. Staining of TLR1 in human PBMCs (lymphocyte-gated) using this antibody at 10 ul/10^6 cells. Shaded histogram represents cells alone, green represents isotype controlwas used for this test.
Flow Cytometry: TLR1 Antibody [NB100-56563] - Intracellular analysis of TLR1 AF647 in human PBMCs (lymphocyte-gated) using this antibody at 10 ul/10^6 cells. Shaded histogram represents cells without antibody, green represents isotype control, red represents TLR1 antibody.
Western Blot: TLR1 Antibody [NB100-56563] - All the cell lines expressed mRNA for TLR1 (Figure 1) and displayed a strong expression of TLR1 protein (Figure 2). Cell lysates were electrophoresed and blotted to PVDF membrane, which was probed with TLR1-specific antibody. To confirm the immunoreactivity of the antibody, different positive controls were included. Beta-actin was served as loading control and was used to normalize expression levels between cells. Data are representative for analysis of >=2 independent experiments. Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pone.0060671) licensed under a CC-BY licence.
(13 Publications)
Species: Hu, Mu, Rt
Applications: DB, Flow-CS, Flow-IC, Flow, IHC, IHC-P, WB
TLR6 Antibody
(86B1153.2) - BSA Fre
NB100-56536
Immunohistochemistry-Paraffin: TLR6 Antibody (86B1153.2) [NB100-56536] - Tonsil probed with TLR6 antibody at 5 ug/ml. Novus's human tissue TMA was used for this test. Staining of formalin-fixed tissues is enhanced by boiling tissue sections in 10 mM sodium citrate buffer, pH 6.0 for 10-20 min followed by cooling at RT for 20 min.
Flow (Intracellular): TLR6 Antibody (86B1153.2) [NB100-56536] - Analysis using the PE conjugate of NB100-56536. Staining of TLR6 in Ramos cells using this antibody. 5 ug/10^6 cells. Shaded histogram represents Ramos cells without antibody; green represents isotype control (BD Pharmingen); red represents this antibody.
Flow Cytometry: TLR6 Antibody (86B1153.2) [NB100-56536] - Cell surface analysis of TLR6 antibody in 10^6 human monocytes using 0.5 ug of this antibody. Shaded histogram represents cells without antibody; green represents isotype control antibody ; red represents anti-TLR6 antibody. goat anti-mouse IgG PE conjugated secondary antibody was used.
(17 Publications)
Species: Hu
Applications: Flow-CS, Flow-IC, Flow, IHC, IHC-P, WB
p38 alpha Antibody
[Unconjugated]
AF8691
Simple Western lane view shows lysates of HeLa human cervical epithelial carcinoma cell line and NIH‑3T3 mouse embryonic fibroblast cell line, loaded at 0.2 mg/mL. A specific band was detected for p38 alpha at approximately 43 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat p38 alpha Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8691). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
Western blot shows lysates of HEK293T human embryonic kidney parental cell line and p38 alpha knockout HEK293T cell line (KO). PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse/Rat p38 alpha Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8691) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for p38 alpha at approximately 38 kDa (as indicated) in the parental HEK293T cell line, but is not detectable in knockout HEK293T cell line. GAPDH (Catalog # AF5718) is shown as a loading control. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Orexin B, p38 alpha , and Integrin  beta 1 were detected in perfusion fixed frozen sections of mouse brainstem using Human Orexin B Monoclonal Antibody (red; Catalog # MAB734), Rabbit Anti-Human/Mouse/Rat p38 alpha Antigen Affinity-purified Polyclonal Antibody (green; Catalog # AF8691), and Mouse Integrin  beta 1 Antigen Affinity-purified Polyclonal Antibody (blue; Catalog # AF2405). Tissue was incubated with primary antibodies overnight at 4 °C. Tissue was stained using NorthernLights™ 493-conjugated Anti-Rabbit IgG Secondary Antibody (green; Catalog # NL006), NorthernLights 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007), and NorthernLights 637-conjugated Anti-Goat IgG Secondary Antibody (blue; Catalog # NL002). The image of Integrin beta 1 is pseudo-colored for presentation. View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
(3 Reviews)
(5 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
IRAK4 Antibody
NB500-597
Western Blot: IRAK4 Antibody [NB500-597] - Analysis of IRAK-4 in 30 ugs of NIH 3T3 cell lysate using this antibody at 1:500 dilution.
(12 Publications)
Species: Hu, Mu, Rt
Applications: Flow, IP, WB

Publications for Tollip Antibody (NBP1-81597)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Tollip Antibody (NBP1-81597) (0)

There are no reviews for Tollip Antibody (NBP1-81597). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Tollip Antibody (NBP1-81597) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Tollip Products

Bioinformatics Tool for Tollip Antibody (NBP1-81597)

Discover related pathways, diseases and genes to Tollip Antibody (NBP1-81597). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Tollip Antibody (NBP1-81597)

Discover more about diseases related to Tollip Antibody (NBP1-81597).
 

Pathways for Tollip Antibody (NBP1-81597)

View related products by pathway.

PTMs for Tollip Antibody (NBP1-81597)

Learn more about PTMs related to Tollip Antibody (NBP1-81597).
 

Research Areas for Tollip Antibody (NBP1-81597)

Find related products by research area.

Blogs on Tollip

There are no specific blogs for Tollip, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Tollip Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol TOLLIP