Tollip Antibody

Images

 
Genetic Strategies: Western Blot: Tollip Antibody [NBP1-81597] - Analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1,. Remaining relative intensity is presented. Loading ...read more
Immunocytochemistry/ Immunofluorescence: Tollip Antibody [NBP1-81597] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: Tollip Antibody [NBP1-81597] - Staining of human cerebral cortex.
Western Blot: Tollip Antibody [NBP1-81597] - Analysis in human cerebral cortex tissue.
Western Blot: Tollip Antibody [NBP1-81597] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Independent Antibodies: Immunohistochemistry-Paraffin: Tollip Antibody [NBP1-81597] - Staining of human cerebral cortex, epididymis, liver and testis using Anti-TOLLIP antibody NBP1-81597 (A) shows similar ...read more
Immunohistochemistry-Paraffin: Tollip Antibody [NBP1-81597] - Staining of human liver.
Immunohistochemistry-Paraffin: Tollip Antibody [NBP1-81597] - Staining of human testis.
Immunohistochemistry-Paraffin: Tollip Antibody [NBP1-81597] - Staining of human epididymis.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Tollip Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VEDKWYSLSGRQGDDKEGMINLVMSYALLPAAMVMPPQPVVLMPTVYQQGVGYVPITGMPAVCSPGMVPVALPPAAVNAQPRCSEEDLKA
Specificity
Specificity of human, mouse, rat Tollip antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TOLLIP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Tollip Protein (NBP1-81597PEP)
Publications
Read Publications using
NBP1-81597 in the following applications:

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261). Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Tollip Antibody

  • adapter protein
  • FLJ33531
  • IL-1RAcPIP
  • toll interacting protein
  • toll-interacting protein
  • Tollip

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56566
Species: Hu, Mu, Rt, Po, Bv, Ma
Applications: WB, ChIP, DB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, PAGE, B/N, CyTOF-ready, Dual ISH-IHC, ELISA(Cap), Flow-CS, Flow-IC, KD, KO
NB100-56722
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, DB, ELISA, Flow, Func, ICC/IF, IP, In vitro, B/N, Flow-CS
NBP1-77068
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IP
NBP2-29328
Species: Hu, Mu, Rt, Xp, Ye, Ze
Applications: ELISA
NB100-56583
Species: Hu, Rt, Rb
Applications: WB, Flow, IHC, IHC-P, KO
NBP2-24729
Species: Hu, Mu, Rt, Ca, Eq, Pm, Pm
Applications: WB, Simple Western, DB, ELISA, Flow, Func, ICC/IF, IHC, IHC-P, IP, In vitro, B/N, CyTOF-ready, Flow-IC, KD
NB120-13810
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, IB, ICC/IF, IP, KD
NBP1-86170
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24787
Species: Hu, Mu, Ca
Applications: WB, DB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-CS, Flow-IC
AF1092
Species: Mu
Applications: WB
NB100-56655
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56563
Species: Hu, Mu, Rt
Applications: WB, DB, Flow, IHC, IHC-P, Flow-CS, Flow-IC
NB100-56536
Species: Hu
Applications: WB, Flow, IHC, IHC-P, Flow-CS, Flow-IC
AF8691
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, KO
NB500-597
Species: Hu, Mu, Rt
Applications: WB, Flow, IP

Publications for Tollip Antibody (NBP1-81597)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Tollip Antibody (NBP1-81597) (0)

There are no reviews for Tollip Antibody (NBP1-81597). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Tollip Antibody (NBP1-81597) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Tollip Products

Bioinformatics Tool for Tollip Antibody (NBP1-81597)

Discover related pathways, diseases and genes to Tollip Antibody (NBP1-81597). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Tollip Antibody (NBP1-81597)

Discover more about diseases related to Tollip Antibody (NBP1-81597).
 

Pathways for Tollip Antibody (NBP1-81597)

View related products by pathway.

PTMs for Tollip Antibody (NBP1-81597)

Learn more about PTMs related to Tollip Antibody (NBP1-81597).

Blogs on Tollip

There are no specific blogs for Tollip, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Tollip Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TOLLIP