Home » Tollip » Tollip Antibodies » Tollip Antibody

Tollip Antibody

 (2 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: Tollip Antibody [NBP1-81597] - Analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1,. Remaining relative intensity is presented. Loading control: Anti-PPIB.
Genetic Strategies: Western Blot: Tollip Antibody [NBP1-81597] - Analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1,. Remaining relative intensity is presented. Loading ...read more
Immunocytochemistry/ Immunofluorescence: Tollip Antibody [NBP1-81597] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: Tollip Antibody [NBP1-81597] - Staining of human cerebral cortex.
Western Blot: Tollip Antibody [NBP1-81597] - Analysis in human cerebral cortex tissue.
Western Blot: Tollip Antibody [NBP1-81597] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Independent Antibodies: Immunohistochemistry-Paraffin: Tollip Antibody [NBP1-81597] - Staining of human cerebral cortex, epididymis, liver and testis using Anti-TOLLIP antibody NBP1-81597 (A) shows similar ...read more
Immunohistochemistry-Paraffin: Tollip Antibody [NBP1-81597] - Staining of human liver.
Immunohistochemistry-Paraffin: Tollip Antibody [NBP1-81597] - Staining of human testis.
Immunohistochemistry-Paraffin: Tollip Antibody [NBP1-81597] - Staining of human epididymis.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

    

Genetic Strategies

    

Order Details

100% Guarantee on every product

Tollip Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VEDKWYSLSGRQGDDKEGMINLVMSYALLPAAMVMPPQPVVLMPTVYQQGVGYVPITGMPAVCSPGMVPVALPPAAVNAQPRCSEEDLKA
Specificity
Specificity of human, mouse, rat Tollip antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TOLLIP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Tollip Protein (NBP1-81597PEP)
Publications
Read Publications using
NBP1-81597 in the following applications:

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261). Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Tollip Antibody

  • adapter protein
  • FLJ33531
  • IL-1RAcPIP
  • toll interacting protein
  • toll-interacting protein
  • Tollip

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

TLR4 Antibody
(76B357.1)
NB100-56566
Dual RNAscope ISH-IHC: TLR4 Antibody (76B357.1) [NB100-56566] - FFPE tissue sections of human tonsil were probed for TLR4 mRNA (ACD RNAScope Probe, ACD catalog # 311281; Fast Red chromogen, ACD catalog # 322750). Adjacent tissue section was processed for immunohistochemistry using Mouse Monoclonal (Novus Biologicals catalog # NB100-56566) at 5ug/mL with 1 hour incubation at room temperature followed by incubation with anti-mouse IgG VisUCyte HRP Polymer Antibody (Catalog # VC001) and DAB chromogen (yellow-brown). Tissue was counterstained with hematoxylin (blue). Specific staining was localized to lymphocytes.
Flow Cytometry: TLR4 Antibody (76B357.1) [NB100-56566] - Analysis using the Alexa Fluor (R) 647 conjugate of NBP2-27149. TLR4 expression on monocytes from human peripheral blood. PBMC were stained in a 2 color flow test, with CD14 PE version of this antibody and 1 ug of either isotype control (left) or TLR4-Alexa Fluor 647 (right). PPI negative, CD14+ cells were gated for analysis.
Immunohistochemistry: TLR4 Antibody (76B357.1) [NB100-56566] - Pericryptal Myofibroblasts are Responsible for Increased TLR4 Expression in a Subset of CRCs. Double-stained immunofluorescence for TLR4 (green) and vimentin (red) in normal (I), adenoma (II), and colon adenocarcinoma (III) (10x). In the stromal compartment of CRCs, immunofluorescent staining for TLR4 localized to the pericryptal myofibroblasts in a subset of samples. Image collected and cropped by CiteAb from the following publication (http://www.jeccr.com/content/33/1/45), licensed under a CC-BY licence.
(5 Reviews)
(105 Publications)
Species: Hu, Mu, Rt, Po, Bv, Ma
Applications: WB, ChIP, DB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, PAGE, B/N, CyTOF-ready, Dual ISH-IHC, ELISA(Cap), Flow-CS, Flow-IC, KD, KO
TLR2 Antibody
(TL2.1)
NB100-56722
Flow Cytometry: TLR2 Antibody (TL2.1) [NB100-56722] - Analysis using the FITC conjugate of NB100-56726. Surface staining of stable HEK293/hTLR2 cells (IML-202, red) and vector control cells (IML-200, green) using TLR2 antibody at 1 ug/10^6 cells.
Western Blot: TLR2 Antibody (TL2.1) [NB100-56722] - Expression of TLR2 was determined by western blotting. The immunoreactivity of the anti-TLR2 was confirmed with human intestinal lysate. Data are representative for analysis of >=2 independent experiments. Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pone.0060671) licensed under a CC-BY licence.
Western Blot: TLR2 Antibody (TL2.1) [NB100-56722] - Total protein from human THP-1 and U937 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-TLR2 (NB100-56722) in 5% BSA-TBST and detected with an anti-mouse HRP secondary antibody using NovaLume chemiluminescence detection reagent (NPB2-61915).
(60 Publications)
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, DB, ELISA, Flow, Func, ICC/IF, IP, In vitro, B/N, Flow-CS
IRAK1 Antibody
NBP1-77068
Western Blot: IRAK1 Antibody [NBP1-77068] - Species Activity in Mouse and Rat Cell Lines. Loading: 15 ug of lysates per lane.Antibodies: IRAK NBP1-77068 (1 ug/mL,), 1h incubation at RT in 5% NFDM/TBST.Secondary: Goat anti-rabbit IgG HRP conjugate at 1:10000 dilution.
Immunocytochemistry/Immunofluorescence: IRAK1 Antibody [NBP1-77068] - Immunofluorescence Validation of IRAK in Human HeLa Cells. Immunofluorescent analysis of 4% paraformaldehyde-fixed HeLa Cells labeling IRAK with NBP1-77068 at 20 ug g/mL, followed by goat anti-rabbit IgG secondary antibody at 1/500 dilution (red).
Western Blot: IRAK1 Antibody [NBP1-77068] - Western Blot Validation in Human Cell Lines. Loading: 15 ug of lysates per lane.Antibodies: IRAK NBP1-77068 (1 ug/mL), 1h incubation at RT in 5% NFDM/TBST.Secondary: Goat anti-rabbit IgG HRP conjugate at 1:10000 dilution.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IP
MyD88 Inhibitor
Peptide Set
NBP2-29328
MyD88 Inhibitor Peptide Set
(3 Reviews)
(87 Publications)
Species: Hu, Mu, Rt, Xp, Ye, Ze
Applications: ELISA
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(35 Reviews)
(658 Publications)
Species: Hu
NFkB p105/p50
Antibody (2J10D7)
NB100-56583
Western Blot: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - Analysis of p50 in HeLa lysate in the A) absence and B) presence of immunizing peptide using p50 antibody at 5 ug/ml.
Immunohistochemistry-Paraffin: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - IHC-P of rabbit aorta using NB100-56583. Secondary antibody: anti-mouse histofine ( Nisherei Bioscience Inc. ref: 414131F). Development: DAB (Dako ref: K346811-2) and counterstained with Hematoxylin. Submitted via verified customer review
Flow Cytometry: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - An intracellular stain was performed on U937 cells with NFkB p105/p50 [2J10D7] Antibody NB100-56583C (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to DyLight 650.
(1 Review)
(4 Publications)
Species: Hu, Rt, Rb
Applications: WB, Flow, IHC, IHC-P, KO
IL-1 beta/IL-1F2
[Unconjugated]
201-LB
1 μg/lane of Recombinant Human IL-1 beta /IL-1F2 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 17 kDa.
Recombinant Human IL-1 beta /IL-1F2 (Catalog # 201-LB) stimulates cell proliferation of the D10.G4.1 mouse helper T cell line. The ED50 for this effect is <12 pg/mL.
(18 Reviews)
(419 Publications)
Species: Hu
TRAF-6 Inhibitor
Peptide Set
NBP2-26506
TRAF6 Inhibitor Peptide Set [NBP2-26506] - The TRAF6 inhibitory peptide inhibits osteoclast ifferentiation: RAW264.7 cells were plated on 24-well plates and stimulated with RANKL and M-CSF and incubated in the presence of different concentrations of control peptide (PTD) or the TRAF6. The TRAF6 at the concentration above 30 uM suppressed osteoclast differentiation.
(15 Publications)
Species: Hu, Mu, Rt
IL-6 [HRP]
D6050
(26 Reviews)
(490 Publications)
Species: Hu
TLR9 Antibody
(26C593.2)
NBP2-24729
Simple Western: TLR9 Antibody (26C593.2) [NBP2-24729] - Lane view shows a specific band for TLR9 in 0.5 mg/ml of Ramos lysate. This experiment was performed under reducing conditions using the 66-440 kDa separation system. Image using the Azide Free format of this antibody.
Flow Cytometry: TLR9 Antibody (26C593.2) [NBP2-24729] - Expression of TLR9 protein on epithelial cells. HNEC, Detroit-562 and FaDu were stained intracellularly with PE-Ab against TLR9 (open histograms) or appropriate isotype control (shaded histograms) and analyzed by flow cytometry. Representative pictures from one out of three independent experiments are shown. Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0098239), licensed under a CC-BY licence.
Knockdown Validated: TLR9 Antibody (26C593.2) [NBP2-24729] - Expression of TLR-9 protein in HB cells before and after 48 hr of transfection. Beta-actin was used as an internal control. Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pone.0092748) licensed under a CC-BY licence.
(4 Reviews)
(142 Publications)
Species: Hu, Mu, Rt, Ca, Eq, Pm, Pm
Applications: WB, Simple Western, DB, ELISA, Flow, Func, ICC/IF, IHC, IHC-P, IP, In vitro, B/N, CyTOF-ready, Flow-IC, KD
TRIF/TICAM1
Antibody
NB120-13810
Simple Western: TRIF/TICAM1 Antibody [NB120-13810] - Image shows a specific band for TRIF in 0.5 mg/mL of Raji lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Western Blot: TRIF/TICAM1 Antibody [NB120-13810] - Analysis of TRIF in mouse spleen probed with TRIF antibody, in A: presence and B: absence of immunizing peptide, at 1:1000.
Immunocytochemistry/Immunofluorescence: TRIF/TICAM1 Antibody [NB120-13810] - TRIF antibody was tested in A431 cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red). Image objective 40X. An antibody dilution of 1:10 was used.
(31 Publications)
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, IB, ICC/IF, IP, KD
TIRAP (TLR2 and
TLR4) Inhibitor Pepti ...
NBP2-26245
TIRAP (TLR2 and TLR4) Inhibitor Peptide [NBP2-26245] - TLR2 acts through formation of heterodimer complexes with TLR1 or TLR6. HEK 293 endogenously expresses TLR1 and TLR6, so that the TLR2 reporter cell line can response to both Pam3CSK4 (TLR2/TLR1 specific ligand) and MALP-2 (TLR2/TLR6 specific ligand). The TLR2 / TLR4 inhibitor specifically inhibits TLR2/TLR1 receptor complex activity in a dose-response manner but exhibited no or little effect on TLR2/TLR6 receptor complex activity.
TIRAP (TLR2 and TLR4) Inhibitor Peptide [NBP2-26245] - The TLR4 reporter cell line responds to LPS. The TLR2 / TLR4 inhibitor specifically inhibits TLR4 activation upon LPS stimulation in a dose-response manner.
TIRAP (TLR2 and TLR4) Inhibitor Peptide [NBP2-26245] - TLR2 /4 Inhibitor suppressed the Pam3CSK4-induced TLR2/TLR1 activity [A] and the LPS-induced TLR4 activity [B] in a dose-response manner, of which IC50 values were measured as 17.2 uM and 10.47 uM, respectively.
(6 Publications)
Species: Hu, Mu
TOM1 Antibody
NBP1-86170
Western Blot: TOM1 Antibody [NBP1-86170] - Lane 1: Marker [kDa] 207, 110, 79, 49, 32, 25, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line EFO-21. Lane 4: Human cell line A-431. Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunohistochemistry-Paraffin: TOM1 Antibody [NBP1-86170] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: TOM1 Antibody [NBP1-86170] - Staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.
Species: Hu
Applications: WB, IHC, IHC-P
TLR5 Antibody
(19D759.2)
NBP2-24787
Immunohistochemistry-Paraffin: TLR5 Antibody (19D759.2) [NBP2-24787] - Analysis of FFPE tissue section of normal human skin using 5 ug/ml concentration of TLR5 antibody (clone 19D759.2). Intense membrane staining of TLR5 was observed specifically in the pigmented basel cells of epidermal layer [10X Magnification]
Flow Cytometry: TLR5 Antibody (19D759.2) [NBP2-24787] - Analysis using the PE conjugate of NBP2-24787. Staining of CD14-/CD83+/TLR5+ diffferentiated myeloid dendritic cells (mDCs). PBMCs were stimulated 5 days with GM-CSF+IL4 prior to the staining. The cells were stained for surface markers CD14 and CD83 FITC, and TLR5 PE. CD14- cells were gated and stained with PE-conjugated isotype control (mouse IgG2a), and FITC-conjugated CD83 (left). CD14- cells were gated and stained with 1 ug PE-conjugated TLR5, and FITC-conjugated CD83 (right).
Western Blot: TLR5 Antibody (19D759.2) [NBP2-24787] - BEAS-2B cells whole cell lysate. Image from verified customer review.
(1 Review)
(36 Publications)
Species: Hu, Mu, Ca
Applications: WB, DB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-CS, Flow-IC
SIGIRR Antibody
[Unconjugated]
AF1092
SIGIRR Antibody [Unconjugated]
(3 Publications)
Species: Mu
Applications: WB
MD-2 Antibody
NB100-56655
Western Blot: MD-2 Antibody [NB100-56655] - Lanes containing cell lysate from untreated cell are on the left (-) and lysates from IFNG treated cells are on the right (+). The proteins are identified by the corresponding gene names. The housekeeping enzyme glyceraldehyde 3-phosphate dehydrogenase (GAPDH) was blotted as a control that is not altered by IFNG treatment. Except for GAPDH, the numbers under each gene name are the fold changes in mRNAs. Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pone.0185956) licensed under a CC-BY licence. anti-TLR4 (Novus Biological NBP2-24538).
Western Blot: MD-2 Antibody [NB100-56655] - Inactivation of MEK-ERK1/2 and NF-kappaB signalling rescues the adverse effects of MD-1 deficiency on Ang II-induced myocyte hypertrophy. Representative western blot of quantitative analysis of the TLR4 and MD-2 protein levels in WT and MD-1-/- mice at 4 weeks after sham or AB surgery (n = 4). *P < 0.05 vs. WT/shams; #P < 0.05 vs. WT/AB. Image collected and cropped by CiteAb from the following publication (https://www.nature.com/articles/srep41857) licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: MD-2 Antibody [NB100-56655] - Analysis of MD2 in human brain tissue using an isotype control antibody (top left) and MD2 antibody (bottom left, right) at 10 ug/ml.
(6 Publications)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
TLR1 Antibody
NB100-56563
Flow Cytometry: TLR1 Antibody [NB100-56563] - TLR1 expression pattern in primary BMNCs from 3 MM patients analyzed by flow cytometry. CD138-positive cells were gated from the total cell population. Staining for was compared with isotype-matched controls (NC). Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pone.0060671) licensed under a CC-BY licence.
Western Blot: TLR1 Antibody [NB100-56563] - analysis of TLR1 in Ramos (A), Raw (B), and (C) TLR1 transfected cell lysate using this antibody. goat anti-rabbit HRP secondary antibody was used.
Western Blot: TLR1 Antibody [NB100-56563] - All the cell lines expressed mRNA for TLR1 (Figure 1) and displayed a strong expression of TLR1 protein (Figure 2). Cell lysates were electrophoresed and blotted to PVDF membrane, which was probed with TLR1-specific antibody. To confirm the immunoreactivity of the antibody, different positive controls were included. Beta-actin was served as loading control and was used to normalize expression levels between cells. Data are representative for analysis of >=2 independent experiments. Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pone.0060671) licensed under a CC-BY licence.
(13 Publications)
Species: Hu, Mu, Rt
Applications: WB, DB, Flow, IHC, IHC-P, Flow-CS, Flow-IC
TLR6 Antibody
(86B1153.2)
NB100-56536
Immunohistochemistry-Paraffin: TLR6 Antibody (86B1153.2) [NB100-56536] - Tonsil probed with TLR6 antibody at 5 ug/ml. Novus's human tissue TMA was used for this test. Staining of formalin-fixed tissues is enhanced by boiling tissue sections in 10 mM sodium citrate buffer, pH 6.0 for 10-20 min followed by cooling at RT for 20 min.
Flow (Intracellular): TLR6 Antibody (86B1153.2) [NB100-56536] - Analysis using the PE conjugate of NB100-56536. Staining of TLR6 in Ramos cells using this antibody. 5 ug/10^6 cells. Shaded histogram represents Ramos cells without antibody; green represents isotype control (BD Pharmingen); red represents this antibody.
Flow Cytometry: TLR6 Antibody (86B1153.2) [NB100-56536] - Cell surface analysis of TLR6 antibody in 10^6 human monocytes using 0.5 ug of this antibody. Shaded histogram represents cells without antibody; green represents isotype control antibody ; red represents anti-TLR6 antibody. goat anti-mouse IgG PE conjugated secondary antibody was used.
(17 Publications)
Species: Hu
Applications: WB, Flow, IHC, IHC-P, Flow-CS, Flow-IC
p38 alpha Antibody
[Unconjugated]
AF8691
Western blot shows recombinant human p38 beta, p38 gamma, p38δ and Recombinant Human Active p38 alpha (Catalog # 5477-KS) (2 ng/lane). PVDF membrane was probed with 0.5 µg/mL Rabbit Anti-Human/Mouse/Rat p38 alpha Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8691) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of HeLa human cervical epithelial carcinoma cell line and NIH‑3T3 mouse embryonic fibroblast cell line, loaded at 0.2 mg/mL. A specific band was detected for p38 alpha at approximately 43 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat p38 alpha Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8691). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
Western blot shows lysates of HEK293T human embryonic kidney parental cell line and p38 alpha knockout HEK293T cell line (KO). PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse/Rat p38 alpha Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8691) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for p38 alpha at approximately 38 kDa (as indicated) in the parental HEK293T cell line, but is not detectable in knockout HEK293T cell line. GAPDH (Catalog # AF5718) is shown as a loading control. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(2 Reviews)
(4 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, KO
IRAK4 Antibody
NB500-597
Western Blot: IRAK4 Antibody [NB500-597] - Analysis of IRAK-4 in 30 ugs of NIH 3T3 cell lysate using this antibody at 1:500 dilution.
(12 Publications)
Species: Hu, Mu, Rt
Applications: WB, Flow, IP

Publications for Tollip Antibody (NBP1-81597)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Tollip Antibody (NBP1-81597) (0)

There are no reviews for Tollip Antibody (NBP1-81597). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Tollip Antibody (NBP1-81597) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional Tollip Products

Bioinformatics Tool for Tollip Antibody (NBP1-81597)

Discover related pathways, diseases and genes to Tollip Antibody (NBP1-81597). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Tollip Antibody (NBP1-81597)

Discover more about diseases related to Tollip Antibody (NBP1-81597).
 

Pathways for Tollip Antibody (NBP1-81597)

View related products by pathway.

PTMs for Tollip Antibody (NBP1-81597)

Learn more about PTMs related to Tollip Antibody (NBP1-81597).

Blogs on Tollip

There are no specific blogs for Tollip, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Tollip Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol TOLLIP