Home » Tollip » Tollip Antibodies » Tollip Antibody

Tollip Antibody

 (2 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: Tollip Antibody [NBP1-81597] - Analysis in human cerebral cortex tissue.
Western Blot: Tollip Antibody [NBP1-81597] - Analysis in human cerebral cortex tissue.
Immunocytochemistry/ Immunofluorescence: Tollip Antibody [NBP1-81597] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: Tollip Antibody [NBP1-81597] - Staining of human small intestine shows strong cytoplasmic and membrane positivity in glandular cells.
Western Blot: Tollip Antibody [NBP1-81597] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Western Blot: Tollip Antibody [NBP1-81597] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Tollip Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VEDKWYSLSGRQGDDKEGMINLVMSYALLPAAMVMPPQPVVLMPTVYQQGVGYVPITGMPAVCSPGMVPVALPPAAVNAQPRCSEEDLKA
Specificity
Specificity of human, mouse, rat Tollip antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TOLLIP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Tollip Protein (NBP1-81597PEP)
Publications
Read Publications using
NBP1-81597 in the following applications:

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Tollip Antibody

  • adapter protein
  • FLJ33531
  • IL-1RAcPIP
  • toll interacting protein
  • toll-interacting protein
  • Tollip

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

TLR4 Antibody
(76B357.1)
NB100-56566
Western Blot: TLR4 Antibody (76B357.1) [NB100-56566] - Analysis using 2 ug/ml on (A) human intestine and 6 ug/ml on (B) mouse intestine and C) rat intestine lysate.
Immunohistochemistry-Paraffin: TLR4 Antibody (76B357.1) [NB100-56566] - Formalin-fixed, paraffin-embedded human skin stained with at 5 ug/ml, peroxidase-conjugate and DAB chromogen. Staining of formalin-fixed tissues is enhanced by boiling tissue sections in 10 mM sodium citrate buffer, pH 6.0 for 10-20 min followed by cooling at RT for 20 min.
Flow (Intracellular): TLR4 Antibody (76B357.1) [NB100-56566] - Analysis using PE conjugate of NBP2-27149. An intracellular stain was performed on Jurkat cells with TLR4 antibody (76B357.1) NBP2-27149PE (blue) and an isotype control MAB004 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to phycoerythrin.
(5 Reviews)
(70 Publications)
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, ELISA(Cap), Flow-CS, Flow-IC
TLR2 Antibody
(TL2.1)
NB100-56722
Western Blot: TLR2 Antibody (TL2.1) [NB100-56722] - Using the Biotin direct conjugate Detection of TLR2 mRNA in multiple cell lines. No detection was observed in L363 or Fravel cell lines. [PMID: 23593278]
Flow Cytometry: TLR2 Antibody (TL2.1) [NB100-56722] - Analysis using the PE conjugate of NB100-56726. Staining of TLR2 on PBMC using this antibody at 1 ug/10^6 cells. Green represents isotype control this antibody; red represents anti-TLR2 antibody.
Flow Cytometry: TLR2 Antibody (TL2.1) [NB100-56722] - Analysis using Azide Free version of NB100-56722. Intracellular TLR2 in 10^6 PBMs using 2 ug of TLR2 antibody. Shaded histogram represents cells without antibody; green represents isotype control ; red represents TLR2 antibody. goat anti-mouse IgG FITC se
(58 Publications)
Species: Hu, Ca
Applications: WB, B/N, Flow, ICC/IF, IHC-P, IP, Flow-CS
IRAK1 Antibody
NB100-56699
Western Blot: IRAK1 Antibody [NB100-56699] - IRAK Antibody [NB100-56699] - Analysis of IRAK-1 in 1) human HeLa and 2) mouse NIH3T3 lysate using IRAK-1 antibody at 1 ug/ml.
Species: Hu, Mu, Rt
Applications: WB, IP
MyD88 Inhibitor
Peptide Set
NBP2-29328
MyD88 Inhibitor Peptide Set
(3 Reviews)
(64 Publications)
Species: Hu, Mu, Rt, Xp, Ye, Ze
Applications: ELISA
TNF-alpha
[Unconjugated]
210-TA
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
(19 Reviews)
(506 Publications)
Species: Hu
NFkB p105/p50
Antibody (2J10D7)
NB100-56583
Western Blot: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - analysis of p50 in HeLa lysate in the A) absence and B) presence of immunizing peptide using p50 antibody at 5 ug/ml.
Immunohistochemistry-Paraffin: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - analysis of human breast tumor tissue using an isotype control antibody (top) and p50 antibody (bottom) at 5 ug/ml.
Flow Cytometry: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - An intracellular stain was performed on Jurkat cells with NFkB p105/p50 Antibody (2J10D7) NB100-56583C (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes. Both antibodies were conjugated to Dylight 650.
(1 Review)
(1 Publication)
Species: Hu
Applications: WB, Flow, IHC-P
IL-1 beta/IL-1F2
[Unconjugated]
201-LB
1 μg/lane of Recombinant Human IL-1 beta /IL-1F2 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 17 kDa.
Recombinant Human IL-1 beta /IL-1F2 (Catalog # 201-LB) stimulates cell proliferation of the D10.G4.1 mouse helper T cell line. The ED50 for this effect is <12 pg/mL.
(6 Reviews)
(325 Publications)
Species: Hu
TRAF-6 Inhibitor
Peptide Set
NBP2-26506
TRAF6 Inhibitor Peptide Set [NBP2-26506] - The TRAF6 inhibitory peptide inhibits osteoclast ifferentiation: RAW264.7 cells were plated on 24-well plates and stimulated with RANKL and M-CSF and incubated in the presence of different concentrations of control peptide (PTD) or the TRAF6. The TRAF6 at the concentration above 30 uM suppressed osteoclast differentiation.
(13 Publications)
Species: Hu, Mu, Rt
TLR9 Antibody
(26C593.2)
NBP2-24729
Western Blot: TLR9 Antibody (26C593.2) [NBP2-24729] - Analysis of TLR9 in A) human PBMC, B) human intestine, C) mouse intestine, and D) rat intestine tissue lysates using Azide free TLR9 antibody at a dilution of 3 ug/ml.
Immunohistochemistry-Paraffin: TLR9 Antibody (26C593.2) [NBP2-24729] - Monkey retina tissue. This image was submitted via customer review.
Flow Cytometry: TLR9 Antibody (26C593.2) [NBP2-24729] - Flow analysis of TLR9 in human PBMC using 0.5 ug of TLR9 antibody (red) and isotype control antibody (green).
(4 Reviews)
(134 Publications)
Species: Hu, Mu, Rt, Ca, Eq, Mk, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, In vitro, CyTOF-ready, Flow-IC
TRIF/TICAM1
Antibody
NB120-13810
Western Blot: TRIF/TICAM1 Antibody [NB120-13810] - Analysis of TRIF in mouse spleen probed with TRIF antibody, in the A) presence and B) absence of immunizing peptide, at 1:1000.
Immunocytochemistry/Immunofluorescence: TRIF/TICAM1 Antibody [NB120-13810] - TRIF antibody was tested in A431 cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red). Image objective 40x. An antibody dilution of 1:10 was used.
Western Blot: TRIF/TICAM1 Antibody [NB120-13810] - Analysis of TRIF in mouse A) intestine, B) spleen and C) RAW lysate using TRIF antibody at 1:1000 dilution.
(26 Publications)
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, IB, ICC/IF, IP
TIRAP (TLR2 and
TLR4) Inhibitor Pepti ...
NBP2-26245
TIRAP (TLR2 and TLR4) Inhibitor Peptide [NBP2-26245] - TLR2 acts through formation of heterodimer complexes with TLR1 or TLR6. HEK 293 endogenously expresses TLR1 and TLR6, so that the TLR2 reporter cell line can response to both Pam3CSK4 (TLR2/TLR1 specific ligand) and MALP-2 (TLR2/TLR6 specific ligand). The TLR2 / TLR4 inhibitor specifically inhibits TLR2/TLR1 receptor complex activity in a dose-response manner but exhibited no or little effect on TLR2/TLR6 receptor complex activity.
TIRAP (TLR2 and TLR4) Inhibitor Peptide [NBP2-26245] - The TLR4 reporter cell line responds to LPS. The TLR2 / TLR4 inhibitor specifically inhibits TLR4 activation upon LPS stimulation in a dose-response manner.
TIRAP (TLR2 and TLR4) Inhibitor Peptide [NBP2-26245] - TLR2 /4 Inhibitor suppressed the Pam3CSK4-induced TLR2/TLR1 activity [A] and the LPS-induced TLR4 activity [B] in a dose-response manner, of which IC50 values were measured as 17.2 uM and 10.47 uM, respectively.
(4 Publications)
Species: Hu, Mu
TOM1 Antibody
NBP1-86170
Western Blot: TOM1 Antibody [NBP1-86170] - Lane 1: Marker [kDa] 207, 110, 79, 49, 32, 25, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line EFO-21. Lane 4: Human cell line A-431. Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunocytochemistry/Immunofluorescence: TOM1 Antibody [NBP1-86170] - Staining of human cell line A-431 shows positivity in cytoplasm and centrosome.
Immunohistochemistry-Paraffin: TOM1 Antibody [NBP1-86170] - Staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
TLR5 Antibody
(19D759.2)
NBP2-24787
Western Blot: TLR5 Antibody (19D759.2) [NBP2-24787] - BEAS-2B cells whole cell lysate. Image from verified customer review.
Immunohistochemistry-Paraffin: TLR5 Antibody (19D759.2) [NBP2-24787] - analysis of TLR5 in formalin-fixed, paraffin-embedded mouse brain tissue using TLR5 antibody at 5 ug/ml.
Flow Cytometry: TLR5 Antibody (19D759.2) [NBP2-24787] - Analysis using the PE conjugate of NBP2-24787. Staining of CD14-/CD83+/TLR5+ diffferentiated myeloid dendritic cells (mDCs). PBMCs were stimulated 5 days with GM-CSF+IL4 prior to the staining. The cells were stained for surface markers CD14 and CD83 FITC, and TLR5 PE. CD14- cells were gated and stained with PE-conjugated isotype control (mouse IgG2a), and FITC-conjugated CD83 (left). CD14- cells were gated and stained with 1 ug PE-conjugated TLR5, and FITC-conjugated CD83 (right).
(1 Review)
(28 Publications)
Species: Hu, Mu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-CS, Flow-IC
SIGIRR Antibody
[Unconjugated]
AF1092
SIGIRR Antibody [Unconjugated]
(3 Publications)
Species: Mu
Applications: WB
MD-2 Antibody
NB100-56655
Western Blot: MD-2 Antibody [NB100-56655] - Western Blot Image of anti-MD2. Total protein from human colon (lane 1) and human spleen (lane 2) was separated on a 4-15% gel by SDS-PAGE, transferred to 0.2 um PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2 ug/ml anti-MD2 in 1% milk and detected with an anti-rabbit HRP secondary antibody using chemiluminescence.
Immunohistochemistry-Paraffin: MD-2 Antibody [NB100-56655] - Analysis of MD2 in formalin-fixed, paraffin-embedded human brain tissue using an isotype control antibody (top left) and MD2 antibody (bottom left, right) at 10 ug/ml.
Immunohistochemistry: MD-2 Antibody [NB100-56655] - Staining of normal human brain using 100-56655 (MD-2)at 10 ug/ml.
(5 Publications)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
TLR1 Antibody
NB100-56563
Western Blot: TLR1 Antibody [NB100-56563] - analysis of TLR1 in Ramos (A), Raw (B), and (C) TLR1 transfected cell lysate using this antibody. goat anti-rabbit HRP secondary antibody was used.
Immunohistochemistry-Paraffin: TLR1 Antibody [NB100-56563] - analysisof human small intestine using this antibody at 10 ug/ml.
Flow Cytometry: TLR1 Antibody [NB100-56563] - Intracellular analysis of TLR1 AF647 in human PBMCs (lymphocyte-gated) using this antibody at 10 ul/10^6 cells. Shaded histogram represents cells without antibody, green represents isotype control, red represents TLR1 antibody.
(11 Publications)
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
TLR6 Antibody
(86B1153.2)
NB100-56536
Immunohistochemistry-Paraffin: TLR6 Antibody (86B1153.2) [NB100-56536] - Tonsil probed with TLR6 antibody at 5 ug/ml. Novus's human tissue TMA was used for this test. Staining of formalin-fixed tissues is enhanced by boiling tissue sections in 10 mM sodium citrate buffer, pH 6.0 for 10-20 min followed by cooling at RT for 20 min.
Flow (Intracellular): TLR6 Antibody (86B1153.2) [NB100-56536] - Analysis using the PE conjugate of NB100-56536. Staining of TLR6 in Ramos cells using this antibody. 5 ug/10^6 cells. Shaded histogram represents Ramos cells without antibody; green represents isotype control (BD Pharmingen); red represents this antibody.
Flow Cytometry: TLR6 Antibody (86B1153.2) [NB100-56536] - Cell surface analysis of TLR6 antibody in 10^6 human monocytes using 0.5 ug of this antibody. Shaded histogram represents cells without antibody; green represents isotype control antibody ; red represents anti-TLR6 antibody. goat anti-mouse IgG PE conjugated secondary antibody was used.
(18 Publications)
Species: Hu
Applications: Flow, IHC, IHC-P, Flow-CS, Flow-IC
p38 alpha Antibody
[Unconjugated]
AF8691
Western blot shows recombinant human p38 beta, p38 gamma, p38δ and Recombinant Human Active p38 alpha (Catalog # 5477-KS) (2 ng/lane). PVDF membrane was probed with 0.5 µg/mL Rabbit Anti-Human/Mouse/Rat p38 alpha Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8691) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of HeLa human cervical epithelial carcinoma cell line and NIH‑3T3 mouse embryonic fibroblast cell line, loaded at 0.2 mg/mL. A specific band was detected for p38 alpha at approximately 43 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat p38 alpha Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8691). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
Orexin B, p38 alpha, and Integrin  beta 1 were detected in perfusion fixed frozen sections of mouse brainstem using Human Orexin B Monoclonal Antibody (red; Catalog # MAB734), Rabbit Anti-Human/Mouse/Rat p38 alpha Antigen Affinity-purified Polyclonal Antibody (green; Catalog # AF8691), and Mouse Integrin  beta 1 Antigen Affinity-purified Polyclonal Antibody (blue; Catalog # AF2405). Tissue was incubated with primary antibodies overnight at 4 °C. Tissue was stained using NorthernLights™ 493-conjugated Anti-Rabbit IgG Secondary Antibody (green; Catalog # NL006), NorthernLights 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007), and NorthernLights 637-conjugated Anti-Goat IgG Secondary Antibody (blue; Catalog # NL002). The image of Integrin beta 1 is pseudo-colored for presentation. View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, KO
IRAK4 Antibody
NB500-597
Western Blot: IRAK4 Antibody [NB500-597] - Analysis of IRAK-4 in 30 ugs of NIH 3T3 cell lysate using this antibody at 1:500 dilution.
(11 Publications)
Species: Hu, Mu, Rt
Applications: WB, Flow, IP
Tollip Antibody
NBP1-81597
Tollip Antibody
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Tollip Antibody (NBP1-81597)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Tollip Antibody (NBP1-81597) (0)

There are no reviews for Tollip Antibody (NBP1-81597). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Tollip Antibody (NBP1-81597) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Tollip Antibody (NBP1-81597)

Discover related pathways, diseases and genes to Tollip Antibody (NBP1-81597). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Tollip Antibody (NBP1-81597)

Discover more about diseases related to Tollip Antibody (NBP1-81597).
 

Pathways for Tollip Antibody (NBP1-81597)

View related products by pathway.

PTMs for Tollip Antibody (NBP1-81597)

Learn more about PTMs related to Tollip Antibody (NBP1-81597).

Blogs on Tollip

There are no specific blogs for Tollip, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Tollip Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol TOLLIP
Entrez