Tollip Antibody

Images

 
Independent Antibodies: Immunohistochemistry-Paraffin: Tollip Antibody [NBP1-81597] - Staining of human cerebral cortex, epididymis, liver and testis using Anti-TOLLIP antibody NBP1-81597 (A) shows similar ...read more
Genetic Strategies: Western Blot: Tollip Antibody [NBP1-81597] - Analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1,. Remaining relative intensity is presented. Loading ...read more
Immunocytochemistry/ Immunofluorescence: Tollip Antibody [NBP1-81597] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: Tollip Antibody [NBP1-81597] - Staining of human cerebral cortex.
Western Blot: Tollip Antibody [NBP1-81597] - Analysis in human cerebral cortex tissue.
Western Blot: Tollip Antibody [NBP1-81597] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: Tollip Antibody [NBP1-81597] - Staining of human liver.
Immunohistochemistry-Paraffin: Tollip Antibody [NBP1-81597] - Staining of human testis.
Immunohistochemistry-Paraffin: Tollip Antibody [NBP1-81597] - Staining of human epididymis.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Tollip Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VEDKWYSLSGRQGDDKEGMINLVMSYALLPAAMVMPPQPVVLMPTVYQQGVGYVPITGMPAVCSPGMVPVALPPAAVNAQPRCSEEDLKA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TOLLIP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Tollip Protein (NBP1-81597PEP)
Publications
Read Publications using
NBP1-81597 in the following applications:

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261). Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Tollip Antibody

  • adapter protein
  • FLJ33531
  • IL-1RAcPIP
  • toll interacting protein
  • toll-interacting protein
  • Tollip

Background

TOLLIP is a ubiquitin-binding protein that interacts with several components of the Toll-like receptor (TLR; see MIM 603030) signaling cascade. It is an essential regulator of inflammatory signaling and is involved in trafficking of interleukin-1 receptor (IL1R; MIM 147810) and turnover of IL1R-associated kinase (IRAK, or IRAK1; MIM 300283) (summary by Lo et al., 2009 (PubMed 19444506)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Tollip Antibody (NBP1-81597)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Tollip Antibody (NBP1-81597) (0)

There are no reviews for Tollip Antibody (NBP1-81597). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Tollip Antibody (NBP1-81597) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Tollip Products

Research Areas for Tollip Antibody (NBP1-81597)

Find related products by research area.

Blogs on Tollip

There are no specific blogs for Tollip, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Tollip Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TOLLIP